SecReT6
Protein ID: 365960977
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09710
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2280312..2280743 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDG8XBH1
KEGG IDfco:FCOL_09710
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.80E-11, Aligned region: 28..126
DUF2972 [PF11186], Evalue: 0.0089, Aligned region: 15..94
Protein Sequence: 143 a.a.     [Download]
>gi|365960977|ref|YP_004942544.1| GPW/gp25 family protein [Flavobacterium columnare ATCC 49512]
MIRGSYFKIPIDFDAIIKKQDAINISIDTSIAQHIFLIATTSFGECKFNDDYGTEIWEMDFDILKSDNIL
KETITNTLKKAIATYEKRLSLEDVTVVISDKNIGNISRKRIKKCVSFSVKGQVFETNRPFLFQSSFFVGP
LSY
 
Nucleotide Sequence: 432 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2280743-2280312 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGATTAGAGGTTCTTATTTTAAAATACCTATTGACTTTGACGCAATAATAAAAAAACAAGATGCTATAA
ATATTAGCATTGATACGTCAATAGCCCAACACATTTTTCTAATAGCAACTACTTCTTTTGGAGAGTGCAA
ATTTAATGATGACTACGGAACCGAAATATGGGAAATGGACTTTGATATTTTAAAAAGTGACAATATATTA
AAAGAAACCATTACAAATACTTTAAAGAAAGCCATCGCAACTTACGAAAAAAGGCTTTCCTTAGAAGATG
TTACCGTAGTCATATCTGACAAAAACATTGGAAATATTAGTCGAAAAAGAATCAAAAAATGTGTTTCTTT
TAGTGTTAAAGGACAAGTTTTTGAAACCAATAGACCTTTTTTATTCCAAAGCTCGTTTTTTGTCGGCCCC
TTATCCTATTAA