SecReT6
Protein ID: 365960980
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09725
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2281977..2282492 [-]
Producthypothetical protein
NoteTssO
UniProt IDG8XBH4
KEGG IDfco:FCOL_09725
PDB IDNA
Domain hit(s) vs Pfam DivIC [PF04977], Evalue: 0.0041, Aligned region: 19..61
DivIC [PF04977], Evalue: 0.0041, Aligned region: 118..161
Protein Sequence: 171 a.a.     [Download]
>gi|365960980|ref|YP_004942547.1| hypothetical protein FCOL_09725 [Flavobacterium columnare ATCC 49512]
MEILNKKERSKAFVSFVLFFVISVTVFMSALLFNTYFPFRENELLKTENFKLKKEIEIQNKFSFQLEKVK
TTVDSINAPGQNDFFNEKLALSLLAEMYNQLPKDTLKNKIMYNNTIIAFKDLIDAKKQVKQLATNHKLMD
SLSTINKTLKDEYDKMKRDLEVCRQIYQQAE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2282492-2281977 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGGAAATACTTAATAAAAAAGAACGTTCTAAAGCGTTTGTATCTTTTGTATTGTTTTTTGTAATAAGTG
TAACTGTCTTTATGTCAGCACTCTTATTTAATACTTATTTCCCTTTTAGAGAAAACGAATTATTAAAAAC
AGAAAACTTTAAATTGAAAAAAGAAATTGAAATTCAAAACAAATTTTCTTTTCAACTTGAAAAAGTCAAA
ACTACTGTAGACTCTATTAATGCACCAGGTCAGAATGATTTCTTCAATGAAAAATTAGCTCTTTCATTGT
TAGCAGAAATGTATAATCAACTGCCTAAGGATACATTAAAGAACAAAATAATGTATAACAATACAATTAT
TGCTTTCAAAGATCTAATTGACGCAAAAAAACAAGTAAAACAATTAGCAACCAACCACAAACTGATGGAT
AGTTTGAGCACTATAAATAAAACGCTAAAAGATGAATACGATAAAATGAAACGCGATTTAGAAGTTTGTA
GACAAATCTATCAACAAGCAGAATAA