SecReT6
Protein ID: 365960981
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09730
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2282496..2283653 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8XBH5
KEGG IDfco:FCOL_09730
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0085, Aligned region: 68..94
DUF876 [PF05936], Evalue: 0.0085, Aligned region: 178..240
Protein Sequence: 385 a.a.     [Download]
>gi|365960981|ref|YP_004942548.1| hypothetical protein FCOL_09730 [Flavobacterium columnare ATCC 49512]
MIEKLNYFPVNWIDGMKINKNHFNSIQNFINDSIKDAVGLHTSLISYGLLPSNNPIKLNLMVDSHKSLRV
QVQECHAITPNGSRIEIDDRSETVNTNSTYLEASYEIKGDESLKLWVCISVNYFKRIPFGDSDPEENPPR
YPFTKPEYLLSLIPENELVNETGLGGNFLIIGKVLVNSYESKIDNAYIPPSVYVGSHKRLQELYDEINRF
YGQIEIFSIQIAQKINSKKQANELALMMLLVTDKILDYLGVEINKIRWLGIHKAPSEMLLSVIGLARTLK
NLFDSKSGAGKEELLNYFADWCNVNQGTFENIFLELINNNYNHNQIDISVSKIHKFMDVFENLLSSLSRL
DYIGKKRDGSIFVSEITDERDSLLYGKRSKSFLAD
 
Nucleotide Sequence: 1158 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2283653-2282496 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGATAGAAAAACTAAATTATTTCCCTGTCAATTGGATTGACGGAATGAAAATAAACAAAAACCATTTTA
ATTCAATTCAAAACTTCATTAATGATTCCATAAAAGATGCTGTGGGTTTGCATACCTCTTTAATATCTTA
TGGACTATTGCCTTCTAATAATCCTATCAAACTAAACCTAATGGTTGATAGCCATAAATCATTAAGAGTA
CAAGTTCAAGAATGCCATGCCATAACACCTAATGGTTCTAGAATTGAAATAGATGATAGAAGCGAAACAG
TTAATACAAATTCCACCTACCTAGAAGCCTCCTACGAAATCAAAGGCGATGAGAGCTTAAAATTATGGGT
TTGTATCTCTGTCAATTACTTTAAAAGAATACCTTTTGGTGACTCTGATCCTGAAGAAAACCCTCCAAGA
TATCCTTTTACAAAACCTGAATATTTATTAAGTCTTATTCCTGAAAATGAATTGGTAAATGAAACTGGTT
TAGGAGGAAACTTTTTAATAATAGGAAAAGTACTCGTAAACTCATACGAATCAAAAATAGATAATGCTTA
TATTCCACCATCAGTATATGTAGGAAGTCACAAACGACTACAAGAATTGTATGACGAAATCAATCGTTTT
TATGGACAAATAGAAATATTTTCTATACAAATTGCTCAAAAGATTAATTCTAAAAAACAAGCAAATGAAT
TAGCTCTAATGATGCTATTAGTAACCGATAAAATATTAGACTATTTAGGTGTAGAAATCAACAAAATCAG
ATGGTTAGGAATACACAAAGCACCTTCTGAAATGCTTCTTTCTGTTATTGGGTTAGCAAGAACACTTAAA
AACTTATTTGATTCAAAGTCTGGAGCAGGAAAAGAGGAATTACTAAATTATTTTGCAGATTGGTGTAATG
TTAATCAAGGGACTTTCGAAAACATTTTCTTAGAATTGATAAATAACAATTACAATCACAATCAAATTGA
TATAAGCGTCTCAAAAATTCACAAATTTATGGATGTATTCGAAAATCTCTTATCTTCTCTAAGTCGATTA
GATTACATAGGTAAAAAACGAGATGGAAGTATTTTCGTATCTGAAATTACAGACGAAAGAGACAGCCTTT
TATATGGAAAAAGAAGTAAAAGTTTTTTAGCAGATTAA