SecReT6
Protein ID: 365960982
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09735
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2283842..2285206 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8XBH6
KEGG IDfco:FCOL_09735
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.40E-14, Aligned region: 120..398
Phage_sheath_1 [PF04984], Evalue: 3.30E-05, Aligned region: 275..435
Protein Sequence: 454 a.a.     [Download]
>gi|365960982|ref|YP_004942549.1| hypothetical protein FCOL_09735 [Flavobacterium columnare ATCC 49512]
MAQNKESQHVDSTVLEQKKGQANLEGSLEKLAKFGGFDLLETTIEGAQNLNPDRKARRKIFLSEKDKEKE
RESLKKTLKLWADVLSDATSITDMVSNCEDKRKEAEDLLKKNLSRAVEVTKELETNYRTIALFYKNTETD
KVKNVTIINSDLEQLKDLDNTRFIDTIHAELVNNYDRLDLKNNYGILVIPGYLGSNKVVEKWAKIAHENK
VMLVTDFEHLDEPDDVMEMFDQAYLTGGEVYRSNVLMTCNWLVGRGRFEEIQETEDLYVAPSAALAGKVY
KTLMSQVTAGKKYGGINEVDGVKFDLKKSEIANLESLGLIPMVNEYGKVMAFSAKTLFNGDNLGLQTYSV
VRVFDYVTKVLMDFLNRRAFENFTAVTRKEIMGQIVRFLDSISGPGKLIENFEVKRFEQDPIQKDRIHLD
IHMKPYFPAKNFLIKMDGHKGDDGNEWDTEYEQK
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2285206-2283842 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGGCACAAAATAAAGAAAGTCAACACGTTGACAGTACAGTTTTAGAACAAAAGAAGGGACAGGCTAATT
TAGAAGGTAGCCTAGAAAAGTTAGCAAAATTCGGTGGTTTTGATCTATTAGAAACAACTATTGAAGGAGC
ACAAAATTTAAATCCTGATAGAAAAGCAAGAAGAAAAATTTTTCTTTCTGAAAAGGATAAAGAAAAAGAA
AGAGAATCTTTAAAGAAAACACTTAAGCTTTGGGCTGATGTTCTTTCGGACGCAACAAGTATAACTGACA
TGGTTTCTAATTGCGAAGATAAAAGAAAAGAAGCAGAGGATTTATTGAAGAAAAATTTATCAAGAGCCGT
AGAAGTCACGAAAGAATTAGAAACTAATTATCGTACAATAGCGCTATTTTATAAGAATACAGAAACGGAC
AAGGTAAAAAATGTTACCATTATTAATTCTGATTTAGAACAATTAAAAGATTTAGATAATACTCGATTTA
TAGACACAATTCATGCAGAATTAGTGAATAACTATGATCGTTTAGATCTAAAAAACAACTATGGTATTTT
AGTAATCCCAGGGTATTTAGGTTCTAATAAAGTCGTTGAAAAATGGGCTAAAATTGCGCATGAAAACAAA
GTTATGTTAGTCACAGACTTTGAACATTTAGACGAACCAGATGACGTTATGGAAATGTTTGACCAAGCTT
ATCTAACAGGAGGCGAAGTGTATCGTTCAAATGTATTAATGACTTGTAACTGGCTTGTTGGTAGAGGGCG
ATTTGAAGAAATTCAAGAAACAGAAGACCTATACGTTGCTCCTTCAGCTGCCTTAGCTGGAAAAGTATAC
AAAACATTAATGTCTCAGGTAACAGCTGGTAAAAAGTACGGAGGAATTAACGAAGTAGATGGCGTAAAAT
TTGACCTAAAAAAGAGTGAAATTGCTAATTTAGAAAGCCTTGGATTAATTCCTATGGTAAACGAATACGG
AAAAGTTATGGCGTTTTCTGCTAAGACTCTTTTCAACGGTGATAATTTAGGTTTACAAACCTATTCTGTT
GTTAGGGTTTTTGATTATGTTACAAAAGTATTAATGGATTTCTTAAACAGAAGAGCTTTTGAAAACTTTA
CAGCTGTAACTCGTAAAGAAATCATGGGACAAATCGTTCGCTTCTTAGATTCAATAAGTGGTCCTGGAAA
ACTAATTGAAAATTTTGAAGTAAAAAGATTTGAACAAGATCCTATACAAAAAGATAGAATTCATTTAGAT
ATTCACATGAAACCGTATTTCCCTGCTAAAAACTTCCTCATTAAAATGGATGGACACAAAGGAGATGATG
GAAATGAATGGGATACTGAGTACGAACAAAAATAA