SecReT6
Protein ID: 365960983
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09740
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2285218..2285667 [-]
Producthypothetical protein
NoteTssB
UniProt IDG8XBH7
KEGG IDfco:FCOL_09740
PDB IDNA
Domain hit(s) vs Pfam DUF3461 [PF11944], Evalue: 0.0037, Aligned region: 25..69
DUF3461 [PF11944], Evalue: 0.0037, Aligned region: 106..143
DUF770 [PF05591], Evalue: 0.0046, Aligned region: 50..139
Protein Sequence: 149 a.a.     [Download]
>gi|365960983|ref|YP_004942550.1| hypothetical protein FCOL_09740 [Flavobacterium columnare ATCC 49512]
MLSNHGIGGNEVPLDANEAISEIPQNRTIIAQKLTAESPVKPELVEGLTTIEKVFDHFKPEIKVDFENLD
GSTKMENLNFKNLGDFGVKGITQQSNFLTGLETEKDQYQKIIKQLKSNKILKGALEDPDAKKALLDSLQS
LIKELEENK
 
Nucleotide Sequence: 450 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2285667-2285218 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGTTATCAAATCATGGAATTGGTGGTAATGAAGTACCATTAGACGCAAACGAAGCAATAAGCGAAATCC
CTCAAAACAGAACAATTATTGCTCAAAAACTAACTGCAGAAAGTCCTGTAAAACCAGAACTAGTAGAAGG
ATTAACAACCATTGAAAAAGTTTTCGATCATTTTAAACCTGAAATAAAGGTTGATTTTGAAAATTTAGAT
GGTTCTACTAAAATGGAAAATTTAAACTTTAAAAACCTTGGCGATTTTGGTGTAAAAGGAATTACTCAAC
AAAGTAACTTTTTGACAGGTCTAGAAACAGAAAAAGATCAGTATCAAAAAATTATTAAACAACTTAAGAG
TAATAAAATTCTAAAAGGTGCATTAGAAGATCCTGATGCAAAAAAAGCATTGTTAGATTCATTACAATCT
CTTATTAAAGAACTAGAAGAAAACAAATAA