SecReT6
Protein ID: 365960984
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09745
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2285681..2288149 [-]
ProductATPase
NoteClpV
UniProt IDG8XBH8
KEGG IDfco:FCOL_09745
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.70E-43, Aligned region: 197..218
AAA_2 [PF07724], Evalue: 3.70E-43, Aligned region: 554..715
AAA [PF00004], Evalue: 7.30E-20, Aligned region: 199..310
AAA [PF00004], Evalue: 7.30E-20, Aligned region: 560..676
ClpB_D2-small [PF10431], Evalue: 3.60E-17, Aligned region: 726..803
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 198..217
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 558..677
AAA_16 [PF13191], Evalue: 8.90E-13, Aligned region: 177..220
AAA_16 [PF13191], Evalue: 8.90E-13, Aligned region: 235..280
AAA_16 [PF13191], Evalue: 8.90E-13, Aligned region: 528..595
AAA_16 [PF13191], Evalue: 8.90E-13, Aligned region: 623..653
AAA_22 [PF13401], Evalue: 2.40E-10, Aligned region: 195..295
AAA_22 [PF13401], Evalue: 2.40E-10, Aligned region: 325..361
AAA_22 [PF13401], Evalue: 2.40E-10, Aligned region: 557..582
Sigma54_activat [PF00158], Evalue: 1.00E-07, Aligned region: 195..214
Sigma54_activat [PF00158], Evalue: 1.00E-07, Aligned region: 557..666
IstB_IS21 [PF01695], Evalue: 8.90E-07, Aligned region: 195..227
IstB_IS21 [PF01695], Evalue: 8.90E-07, Aligned region: 558..585
AAA_17 [PF13207], Evalue: 1.00E-06, Aligned region: 46..95
AAA_17 [PF13207], Evalue: 1.00E-06, Aligned region: 199..275
AAA_17 [PF13207], Evalue: 1.00E-06, Aligned region: 421..476
AAA_17 [PF13207], Evalue: 1.00E-06, Aligned region: 562..597
AAA_24 [PF13479], Evalue: 1.00E-06, Aligned region: 46..96
AAA_24 [PF13479], Evalue: 1.00E-06, Aligned region: 196..222
AAA_24 [PF13479], Evalue: 1.00E-06, Aligned region: 559..582
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 196..327
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 304..377
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 406..457
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 561..654
NACHT [PF05729], Evalue: 4.30E-06, Aligned region: 199..228
NACHT [PF05729], Evalue: 4.30E-06, Aligned region: 560..582
ABC_tran [PF00005], Evalue: 1.40E-05, Aligned region: 196..222
ABC_tran [PF00005], Evalue: 1.40E-05, Aligned region: 559..596
Arch_ATPase [PF01637], Evalue: 2.10E-05, Aligned region: 178..310
Arch_ATPase [PF01637], Evalue: 2.10E-05, Aligned region: 559..589
T2SE [PF00437], Evalue: 0.00011, Aligned region: 185..220
T2SE [PF00437], Evalue: 0.00011, Aligned region: 549..632
DUF258 [PF03193], Evalue: 0.00015, Aligned region: 183..219
DUF258 [PF03193], Evalue: 0.00015, Aligned region: 558..578
MobB [PF03205], Evalue: 0.00021, Aligned region: 199..221
MobB [PF03205], Evalue: 0.00021, Aligned region: 560..583
AAA_18 [PF13238], Evalue: 0.00025, Aligned region: 199..280
AAA_18 [PF13238], Evalue: 0.00025, Aligned region: 560..584
Zeta_toxin [PF06414], Evalue: 0.00055, Aligned region: 197..219
Zeta_toxin [PF06414], Evalue: 0.00055, Aligned region: 558..610
RNA_helicase [PF00910], Evalue: 0.00064, Aligned region: 199..221
RNA_helicase [PF00910], Evalue: 0.00064, Aligned region: 559..580
AAA_10 [PF12846], Evalue: 0.00067, Aligned region: 197..479
AAA_10 [PF12846], Evalue: 0.00067, Aligned region: 557..591
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 199..215
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 294..376
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 559..577
UPF0079 [PF02367], Evalue: 0.0014, Aligned region: 198..220
UPF0079 [PF02367], Evalue: 0.0014, Aligned region: 288..337
UPF0079 [PF02367], Evalue: 0.0014, Aligned region: 561..584
Miro [PF08477], Evalue: 0.0016, Aligned region: 199..219
Miro [PF08477], Evalue: 0.0016, Aligned region: 560..581
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 187..240
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 315..371
DUF815 [PF05673], Evalue: 0.0018, Aligned region: 550..590
AAA_33 [PF13671], Evalue: 0.0081, Aligned region: 199..219
AAA_33 [PF13671], Evalue: 0.0081, Aligned region: 339..363
AAA_33 [PF13671], Evalue: 0.0081, Aligned region: 559..577
AAA_29 [PF13555], Evalue: 0.0096, Aligned region: 195..216
AAA_29 [PF13555], Evalue: 0.0096, Aligned region: 557..571
Protein Sequence: 822 a.a.     [Download]
>gi|365960984|ref|YP_004942551.1| ATPase [Flavobacterium columnare ATCC 49512]
MNQEITYNTEVNKAIDIAQKIGRDNLNSHFNGAHLLKAILNRDLSLLKQLESQGIDVYYIEEWAEVKIEE
SPKSTNKYFCEPDEIIDEIFAEADSIRDELKEDEITLLHVMSAICTPGVAFSFEKMKSFPITRNDLLKDT
FKSTAKNTPSINKNGFLQKYCIDKNQQIKTKKKKELLIGRDLEINSITEILCRYSKQNVIILGDSGIGKT
SLIEGFVQKVLLNQIPDLLSQIEIFELDMGALVAGASYKGEIEDRIKNIAQELKHIPKSILIIEEFHSLF
GGNGSDTNIVNLLKSELSKGLTILATSTIEEYTKKIEKEQALSGMFELIKLEEKEDETHFRMLKQTLQDY
QKHHGITIDDATIKEAIRFSKRYMKEKSLPASAIDLIDHTMSVLKTTGDTFINEREHLLNEIKNIEENIG
EIDEDELMLKSEWFLNDLFNKTSFLYTTSNHDINIKNLHFEGISEILNFCRKYIETLEKIANEKRTHITE
LDLALIISQKTNIPIGKLKNEEKQKLNDMEKILAQRVVGQDHAISIVSEAILESRSGLSKAGQPIGSFFF
LGPTGTGKTELAKSLAEFLFQDENAIIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGLLVNKIRQKPYSI
VLFDEIEKAHSSVFDVFLQLMDEGKLHDRLGKEGDFSNAIILFTSNIGSDFIVESFEKDEIPTNAKLLEI
MSRYFRPEFLGRLTESIPFRPISKGNALKIFEIHLKKELIDLAKSIHINLVVSQEVKEFLAEQGYDAKYG
ARPLKGIIRGKLRRPLAKKIVAMEYNEGDTVKVSLKNGELCWEKIKLNIELN
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2288149-2285681 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGAATCAAGAAATTACATACAATACAGAGGTTAATAAAGCTATAGATATTGCACAAAAAATAGGTAGAG
ACAATTTAAATTCACATTTTAACGGAGCTCACTTACTGAAAGCAATCCTTAACAGAGATTTATCATTATT
AAAACAATTAGAATCTCAAGGAATTGATGTTTACTACATTGAGGAATGGGCAGAAGTTAAGATTGAAGAA
TCTCCAAAGTCTACAAACAAATATTTTTGCGAACCCGATGAAATCATAGACGAAATCTTTGCAGAGGCAG
ATTCTATAAGAGACGAATTAAAAGAAGACGAAATAACATTATTACACGTAATGTCTGCTATCTGTACTCC
TGGAGTTGCTTTTAGTTTCGAAAAAATGAAATCGTTCCCTATAACAAGAAACGACTTGCTAAAAGATACT
TTTAAAAGTACAGCAAAAAACACTCCATCTATCAATAAAAATGGGTTTTTACAAAAATACTGTATAGATA
AAAATCAACAAATAAAAACAAAAAAGAAAAAAGAACTACTAATAGGTAGAGATTTAGAAATAAACAGTAT
TACCGAGATACTTTGTAGATACAGCAAACAAAATGTAATTATCTTAGGGGATTCTGGCATTGGAAAGACC
TCCTTAATAGAAGGTTTTGTTCAAAAAGTTTTACTCAATCAAATACCTGACTTGCTATCTCAAATAGAAA
TTTTCGAACTTGATATGGGAGCCTTAGTTGCAGGAGCATCCTATAAAGGAGAAATAGAAGACCGAATAAA
AAATATTGCTCAAGAACTTAAGCATATTCCTAAATCTATTTTGATAATAGAAGAATTCCACTCGCTTTTT
GGAGGCAATGGTTCCGATACAAACATAGTAAATTTACTAAAAAGTGAATTGTCCAAAGGTCTTACGATCC
TAGCTACCTCAACAATAGAAGAGTACACCAAAAAAATCGAAAAAGAACAAGCCTTATCGGGAATGTTCGA
ACTCATTAAATTGGAGGAAAAAGAGGACGAAACCCATTTTAGAATGTTGAAACAAACATTGCAAGATTAT
CAAAAACATCATGGAATAACAATAGATGATGCTACTATAAAGGAAGCAATCCGATTCTCAAAACGATATA
TGAAAGAAAAAAGTCTACCAGCTTCTGCAATAGACTTAATAGATCATACCATGTCCGTACTAAAAACGAC
GGGAGATACTTTTATAAACGAAAGAGAACATTTACTTAATGAAATTAAAAATATTGAAGAAAATATTGGA
GAAATAGACGAAGATGAATTAATGTTAAAATCAGAATGGTTTTTAAATGATTTGTTCAACAAAACAAGCT
TTCTTTATACCACTTCAAATCATGACATTAACATTAAAAATTTGCACTTTGAAGGAATTTCAGAAATCTT
AAATTTCTGTCGAAAATATATCGAAACACTTGAAAAAATAGCTAATGAAAAAAGAACGCATATTACAGAA
CTTGATTTAGCCTTAATCATCTCGCAAAAAACAAATATTCCAATAGGAAAATTAAAAAATGAAGAAAAAC
AAAAACTAAATGACATGGAAAAAATTCTTGCCCAAAGAGTTGTTGGACAAGATCATGCAATTAGTATTGT
TTCAGAAGCTATATTAGAATCCCGTTCGGGCTTAAGCAAAGCGGGACAACCTATTGGTTCATTCTTTTTC
TTGGGACCAACAGGAACAGGAAAAACAGAATTAGCAAAATCATTAGCCGAGTTTCTTTTTCAAGATGAAA
ATGCCATCATTCGTTTTGATATGTCAGAATTTAAAGAAGAACATTCCGCAGCATTACTTTATGGTGCCCC
TCCAGGGTATGTTGGTTATGAAGAAGGAGGATTATTGGTAAATAAAATCAGGCAAAAACCTTATTCCATC
GTCTTATTTGATGAAATAGAAAAAGCCCATAGTTCCGTTTTTGATGTCTTTCTTCAACTAATGGATGAAG
GAAAGTTACACGATAGATTAGGAAAAGAAGGTGATTTTTCCAACGCTATTATCCTATTTACGTCTAACAT
TGGATCAGATTTTATTGTAGAATCCTTTGAAAAAGATGAAATACCTACCAATGCAAAACTACTTGAAATC
ATGAGCAGGTATTTCAGACCCGAATTCTTAGGTCGATTAACAGAATCGATTCCTTTTAGACCTATAAGTA
AAGGGAACGCATTAAAAATATTTGAAATCCATTTAAAAAAGGAATTAATAGATTTAGCAAAAAGCATCCA
TATTAATTTAGTCGTAAGTCAAGAAGTTAAAGAATTTCTTGCTGAACAAGGGTACGATGCAAAATACGGA
GCACGTCCGCTAAAAGGAATCATAAGAGGAAAACTCAGAAGACCTTTAGCCAAAAAAATAGTTGCAATGG
AATACAATGAAGGCGACACCGTAAAAGTTTCTCTAAAAAATGGAGAATTATGTTGGGAAAAAATCAAATT
AAATATAGAGTTAAACTAA