SecReT6
Protein ID: 365960985
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09750
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2288183..2289253 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDG8XBH9
KEGG IDfco:FCOL_09750
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 1.70E-14, Aligned region: 58..106
PKD [PF00801], Evalue: 1.70E-14, Aligned region: 131..192
Protein Sequence: 356 a.a.     [Download]
>gi|365960985|ref|YP_004942552.1| PKD domain-containing protein [Flavobacterium columnare ATCC 49512]
MKRFFNKFNYLTKIDVRIFLGFGLLILLGFGIFLFKYSRHIDCNNGNFLITADEFKPNEVVEFFDNTKGA
SSWEWDFGDSTVVDNRQRTFHKYKKEGDYVVKLIVNGSCYYEKLIRITNVGQQTGYLPLIKAPNVAFLGE
VVRFSAEKNGGESWEWSFGETTSLDAVGQNVSYKFKTTGEKKITLIVNGDLEHIATKIIYVAPKVIVAKQ
KIDMETYEYEKPHSTFSLPRGMAKKDPLEDMLGYIPVSPKHDTHKESTEKTKTTEISNEQFQLLLKQVAA
QVKTKDDFKEYLCGNFEIPVVVNDDNVMSFSELCKSISGKQIKITFLQLNRNENNNCIQNINIKYKTKKW
MIWVKE
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2289253-2288183 Flavobacterium columnare ATCC 49512 chromosome, complete genome
GTGAAACGATTTTTTAACAAATTTAATTATTTAACCAAAATAGATGTAAGAATCTTTTTAGGTTTTGGAC
TTTTAATCCTTTTAGGCTTTGGAATATTCCTTTTTAAATATTCTCGTCATATAGATTGTAACAATGGTAA
CTTTTTAATTACAGCTGACGAATTCAAACCTAATGAGGTGGTTGAGTTTTTTGACAACACCAAAGGTGCT
TCAAGTTGGGAGTGGGATTTTGGAGATAGTACAGTTGTCGATAACCGACAAAGAACATTTCATAAATACA
AAAAAGAAGGAGATTATGTCGTTAAACTAATCGTGAACGGAAGTTGTTACTATGAAAAATTAATACGAAT
AACAAACGTTGGACAACAAACAGGGTATCTCCCCTTAATAAAAGCTCCAAATGTAGCTTTCTTGGGAGAA
GTTGTTCGCTTTAGTGCTGAAAAAAACGGAGGAGAATCTTGGGAATGGAGTTTTGGGGAAACTACATCGT
TAGATGCCGTAGGACAAAATGTGTCCTACAAATTCAAAACAACTGGAGAAAAGAAAATAACCTTAATCGT
TAATGGAGACTTAGAGCACATTGCCACTAAAATAATCTATGTTGCTCCAAAAGTTATTGTTGCTAAACAG
AAAATAGACATGGAAACCTATGAATATGAAAAGCCCCATTCTACCTTTTCTCTTCCTCGAGGAATGGCTA
AAAAAGACCCTCTAGAAGATATGTTAGGATACATTCCTGTATCTCCAAAACATGATACTCATAAAGAATC
AACCGAAAAAACAAAAACAACCGAAATATCTAACGAACAATTTCAACTATTACTAAAACAAGTAGCAGCT
CAAGTAAAAACCAAAGACGATTTTAAAGAGTATTTGTGTGGCAATTTTGAAATCCCTGTTGTTGTAAATG
ATGATAACGTAATGTCTTTTTCAGAATTATGTAAATCTATTTCTGGAAAACAGATTAAAATAACATTCCT
ACAATTAAATAGAAATGAAAATAATAACTGCATTCAGAACATTAATATCAAATACAAAACCAAAAAATGG
ATGATTTGGGTAAAAGAATAG