SecReT6
Protein ID: 365960987
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09760
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2289986..2290918 [+]
Producthypothetical protein
NoteTssG
UniProt IDG8XBI1
KEGG IDfco:FCOL_09760
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 0.00011, Aligned region: 174..308
Protein Sequence: 310 a.a.     [Download]
>gi|365960987|ref|YP_004942554.1| hypothetical protein FCOL_09760 [Flavobacterium columnare ATCC 49512]
MTHLNEILRLIRNIKSDIRAEVIVNDLLNNKIITDNEFIVQKESQFSRTYRRDILEVDIKDFNLDKKEYL
NFTLSRDSLYDLLPEGVFHQSKNEYPDKGVNKMISEYQTQKREEKAARVFFQPFENEFFAHGVSLEDFET
HFLTELNNPSVSELFYEFWGISKEIPHRLASKLIHFLPYTYQIVGNISLATELLSFFLDEKVSIINKGSQ
QYSDEKLAISLGEAQLGIDFISGMEYDDYSLHLEVQIGPLKNSSFLDYILDGKIKNFLDLYYDYFFPMET
DLQTNILIPNDQQNFEFTNKNTILGYNTII
 
Nucleotide Sequence: 933 bp     [Download]
>gi|386262266|ref|NC_016510.2|:2289986-2290918 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGACCCATTTAAATGAAATCTTGCGTTTAATTAGAAATATTAAATCAGATATACGAGCCGAAGTAATAG
TGAATGATTTATTAAATAATAAAATTATCACAGATAATGAATTCATTGTTCAAAAGGAAAGTCAATTTTC
TAGGACCTACAGAAGAGATATACTAGAGGTTGATATAAAAGACTTTAATTTAGATAAAAAAGAATATTTA
AATTTTACTTTATCAAGAGATAGTCTTTATGACTTGCTTCCAGAAGGCGTATTTCATCAATCTAAAAATG
AATATCCTGATAAAGGGGTCAACAAGATGATTAGTGAATACCAAACTCAAAAAAGAGAAGAAAAGGCTGC
ACGCGTTTTTTTTCAACCCTTCGAAAATGAGTTTTTTGCACATGGTGTATCTTTGGAAGATTTTGAAACC
CATTTTCTTACGGAATTAAACAACCCATCGGTTTCCGAATTATTCTATGAATTTTGGGGGATTAGCAAAG
AAATACCGCATCGTTTAGCTTCCAAATTAATACATTTTTTACCCTATACTTATCAAATAGTTGGAAACAT
AAGTTTAGCTACTGAATTATTATCGTTTTTTCTTGATGAAAAAGTTTCTATAATAAATAAAGGATCACAA
CAGTATTCAGATGAAAAACTAGCGATATCATTAGGGGAAGCTCAACTAGGAATAGATTTTATATCAGGTA
TGGAATATGATGATTATTCCTTACACTTAGAAGTACAGATAGGCCCCCTTAAGAACTCCTCCTTTTTAGA
TTATATTTTGGACGGTAAAATAAAAAACTTCTTAGATCTCTATTATGACTATTTTTTTCCTATGGAAACA
GATCTTCAAACGAATATACTTATTCCTAACGACCAACAAAATTTTGAATTTACCAATAAAAACACAATTC
TAGGATACAACACAATTATTTAA