SecReT6
Protein ID: 365960988
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09765
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2291006..2291926 [+]
Producthypothetical protein
NoteTssN
UniProt IDG8XBI2
KEGG IDfco:FCOL_09765
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|365960988|ref|YP_004942555.1| hypothetical protein FCOL_09765 [Flavobacterium columnare ATCC 49512]
MIFIQKTPGFKEKYKNKFIIYELSVALLYVIITFLGFNNLLSNNAMNCFVFYQVSSLLLGILQVYLYKNY
FNKFEKSEVWFVYFFILITVVYSFFSFAITHTFLNGPDLLYLMSTHFILFFIPQLIYDTFNIGMIIPAKV
YKTWQFPANYIEIAGVSDSEMRDLVVITFLIKKDNGDEKYRQYRAKGPTRLDFGRLFYNFVLDYNAKHED
EPIAIQDQNGLYSWVFFFQTKWYESAKYIDPTQTLYMNTITENAVIVCMRTDEIVLDENSKDNDNDDLEY
QYDREKDDKRIGKNNKKETDQMETIS
 
Nucleotide Sequence: 921 bp     [Download]
>gi|386262266|ref|NC_016510.2|:2291006-2291926 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGATTTTTATTCAAAAAACACCAGGTTTTAAAGAAAAATATAAAAATAAATTTATAATTTATGAATTAT
CAGTTGCTTTACTATACGTTATAATTACTTTCCTAGGATTCAATAATTTATTAAGTAATAATGCTATGAA
TTGCTTTGTATTTTATCAAGTATCCTCATTGTTATTGGGAATCTTACAAGTCTATTTGTATAAAAACTAT
TTCAATAAATTTGAAAAAAGCGAAGTTTGGTTTGTCTACTTCTTTATACTCATAACCGTTGTTTATTCCT
TTTTTAGCTTTGCCATAACTCATACATTCTTAAACGGGCCCGATTTATTGTACCTAATGTCTACTCATTT
TATTCTATTTTTTATCCCTCAACTAATTTACGATACATTTAATATAGGAATGATTATACCCGCTAAAGTA
TATAAAACATGGCAGTTTCCTGCTAATTACATAGAAATAGCAGGTGTAAGTGATTCTGAAATGAGGGATT
TAGTGGTAATTACTTTTTTAATTAAAAAAGATAATGGAGATGAAAAATACAGACAATACAGAGCAAAAGG
ACCTACAAGATTAGATTTTGGACGCTTGTTTTACAACTTTGTCTTAGACTATAATGCGAAACATGAAGAC
GAACCTATTGCAATTCAAGACCAAAACGGATTGTACAGCTGGGTATTCTTTTTTCAAACAAAATGGTATG
AATCTGCTAAATATATAGATCCTACTCAAACACTTTATATGAATACAATTACCGAAAATGCCGTTATTGT
TTGTATGAGAACGGATGAAATTGTATTAGATGAAAATAGTAAAGACAATGATAATGATGATCTAGAATAT
CAATACGATAGAGAAAAGGACGATAAAAGAATTGGCAAAAATAATAAAAAAGAAACCGATCAAATGGAAA
CCATAAGCTAA