SecReT6
Protein ID: 365970962
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02670
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2755324..2757246 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8LFB8
KEGG IDeec:EcWSU1_02670
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.60E-76, Aligned region: 22..327
Phage_GPD [PF05954], Evalue: 9.60E-76, Aligned region: 509..562
Phage_base_V [PF04717], Evalue: 1.30E-25, Aligned region: 364..457
Protein Sequence: 640 a.a.     [Download]
>gi|365970962|ref|YP_004952523.1| hypothetical protein EcWSU1_02670 [Enterobacter cloacae EcWSU1]
MLNRITVQLPVEGLLFWKLTGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQSLLTPRYINGK
ITRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGVAYHFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTSAPFFSDNGDYLVTAAGYHFEENRYASGEGETLHRTDFAVIPASVS
YRPAQSTAWPRTYGPQTAKVVGPNGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWIQAERNMDTSIKNDETHSVGGERSHYVKKNELHRVEANQIQAVKGGTEILTGKGKLDAAVEQYVIA
SGTKLRLVSGESAIELNANGKINLIGKEFNFFVEGDGHITTGGKLHLNTSGTQPGTTAPGSGHKGDIDAA
VQEKFTTKGE
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2757246-2755324 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGCTCAACCGAATTACCGTTCAGCTCCCGGTGGAGGGGCTTCTGTTCTGGAAACTCACAGGTCGCGAGG
CGATGTCCGAGTCGTTCGCCCTGACGCTGACCCTGCTTGGCACGGATGCGCGCATTGACCGCAGCAAACT
GCTGGGTCAGCCGGTCACGGTGACCATCCCGACGCAGAGCCTGCTGACGCCCCGCTATATCAATGGAAAA
ATCACCCGCGTGGCGGTGAGTGCCGTCGAGCTGACGGGCACCCGCTATGCGGTGTACCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATCTTCCAGGGCCAGACGGTACCGCAGAT
TGTGAAAACCCTGCTGGGTGAACATCAGGTTAACGTGGAAGATAAGCTCACCGGGAGCTACCGGGTGTGG
GACTACTGCGTGCAGTATCAGGAGTCGAGCCTGGACTTCATCAGCCGTCTGATGGAGCTGGAGGGGGTTG
CGTATCACTTCAGCCACGAGGCGGACAAGCACACGCTGGTGCTCACCGACGCCGCCACGCAGCACCAGCC
GTTCAGCGGCTATGAGGTCATTCCTTACCACCAGACGCCGTCAGGCGGCAGTACGGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGGATTTACAGCCTCGATGACTACGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCGTCACCGAAACCGGGCAGTATCGACGTGTACGA
CTGGCCGGGACGGTTTGTTGAGACCGGGCATGCGGAGTTCTACGCCCGTATCCGTCAGGAGCGCTGGCAG
GTGGAGCACCAGCAGATTCAGGCGACGGCCACGGCCGCGGGTATTGCACCGGGACACACCTTCACCCTGA
CCAGCGCCCCGTTCTTCAGTGATAACGGTGACTATCTGGTCACGGCGGCGGGTTACCATTTCGAGGAGAA
CCGCTACGCGAGCGGCGAGGGTGAAACCCTTCACCGCACTGATTTCGCGGTTATCCCGGCGTCGGTGTCA
TACCGTCCGGCGCAGAGCACGGCGTGGCCGCGCACCTACGGCCCGCAGACGGCAAAGGTTGTGGGGCCAA
ATGGGGAGAGTATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAATTCCACTGGGACCGTCTGGCGAA
GGGGGATGACACCAGCTCCTGCTGGGTGCGCGTGTCGAGCGCCTGGGCGGGTCAGGGGTATGGCGGAGTG
CAAATTCCGCGGGTCGGCGATGAGGTGGTGGTGGACTTTATCAACGGTGACCCGGACCGTCCGATTATCA
CCGGGCGGGTGTATAACGAAGCAAGCATGCCGCCGTGGGCGCTGCCGGCGGCGGCCACGCAGATGGGTTT
TATGAGCCGCACGAAGGATGGCTCCGTGGATAATGCCAATGCCCTGCGCTTTGAGGACAAGGCGGGCGCA
GAGCAGGTGTGGATCCAGGCTGAGCGCAACATGGACACCAGCATTAAGAACGATGAAACGCACAGCGTCG
GTGGCGAGCGCAGCCATTATGTGAAGAAAAATGAACTGCATCGGGTGGAAGCGAATCAGATCCAGGCGGT
GAAAGGCGGAACAGAGATCCTGACGGGCAAAGGCAAGCTGGATGCGGCGGTGGAGCAATATGTCATTGCT
TCCGGTACGAAGCTACGGCTGGTCTCTGGTGAAAGCGCAATTGAGCTGAACGCTAACGGCAAGATTAACC
TCATCGGCAAAGAGTTTAATTTCTTCGTTGAAGGGGATGGTCATATCACCACCGGCGGTAAGCTGCACCT
GAATACGTCTGGCACACAACCGGGCACCACGGCGCCGGGTTCCGGGCATAAAGGGGATATTGATGCGGCA
GTTCAGGAGAAATTTACGACTAAAGGTGAGTAA