SecReT6
Protein ID: 365970967
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02675
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2762249..2764177 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8LFC3
KEGG IDeec:EcWSU1_02675
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.50E-76, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.40E-25, Aligned region: 364..457
Gp5_C [PF06715], Evalue: 0.0033, Aligned region: 500..522
Gp5_C [PF06715], Evalue: 0.0033, Aligned region: 524..535
Gp5_C [PF06715], Evalue: 0.0033, Aligned region: 583..596
Protein Sequence: 642 a.a.     [Download]
>gi|365970967|ref|YP_004952528.1| hypothetical protein EcWSU1_02675 [Enterobacter cloacae EcWSU1]
MLNRITVQLPVEGLLFWKLTGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQSLLTPRYINGK
ITRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGVAYHFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTSAPFFSDNGDYLVTAAGYHFEENRYASGEGETLHRTDFAVIPASVS
YRPAQSTAWPRTYGPQTAKVVGPNGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWIQAERNLDINVKNDETHSTEKNRTQFVGEDETLRVAKNQKSGIKGDVVCLTGNSRNDKVVNNFILS
AGNTLRLECGESAIELSKDGSVHIIGNNFNFTAKQNAQINTLSGELHLNPDDGRNVIDPPGASLQGEIQQ
EVDSFFVINGNK
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2764177-2762249 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGCTCAACCGAATTACCGTTCAGCTCCCGGTGGAGGGGCTTCTGTTCTGGAAACTGACGGGCCGCGAGG
CGATGTCCGAGTCGTTCGCCCTGACGCTGACCCTGCTTGGCACGGATGCGCGCATTGACCGCAGCAAACT
GCTGGGTCAGCCGGTCACGGTGACCATCCCGACGCAGAGCCTGCTGACGCCCCGCTATATCAATGGAAAA
ATCACCCGCGTGGCGGTGAGTGCCGTCGAGCTGACGGGCACCCGCTATGCGGTGTACCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATCTTCCAGGGCCAGACGGTACCGCAGAT
TGTGAAAACCCTGCTGGGTGAACATCAGGTTAACGTGGAAGATAAGCTCACCGGGAGCTACCGGGTGTGG
GACTACTGCGTGCAGTATCAGGAGTCGAGCCTGGACTTCATCAGCCGTCTGATGGAGCTGGAGGGGGTTG
CGTATCACTTCAGCCACGAGGCGGACAAGCACACGCTGGTGCTCACCGACGCCGCCACGCAGCACCAGCC
GTTCAGCGGCTATGAGGTCATTCCTTACCACCAGACGCCGTCAGGCGGCAGTACGGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGGATTTACAGCCTCGATGACTACGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCGTCACCGAAACCGGGCAGTATCGACGTGTACGA
CTGGCCGGGACGGTTTGTTGAGACCGGGCATGCGGAGTTCTACGCCCGTATCCGTCAGGAGCGCTGGCAG
GTGGAGCACCAGCAGATTCAGGCGACGGCCACGGCCGCGGGTATTGCACCGGGACACACCTTCACCCTGA
CCAGCGCCCCGTTCTTCAGTGATAACGGTGACTATCTGGTCACGGCGGCGGGTTACCATTTCGAGGAGAA
CCGCTACGCGAGCGGCGAGGGTGAAACCCTTCACCGCACTGATTTCGCGGTTATCCCGGCGTCGGTGTCA
TACCGTCCGGCGCAGAGCACGGCGTGGCCGCGCACCTACGGCCCGCAGACGGCAAAGGTTGTGGGGCCAA
ATGGGGAGAGTATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAATTCCACTGGGACCGTCTGGCGAA
GGGGGATGACACCAGCTCCTGCTGGGTGCGCGTGTCGAGCGCCTGGGCGGGTCAGGGGTATGGCGGAGTG
CAAATTCCGCGGGTCGGCGATGAGGTGGTGGTGGACTTTATCAACGGTGACCCGGACCGTCCGATTATCA
CCGGGCGGGTGTATAACGAAGCAAGCATGCCGCCGTGGGCGCTGCCGGCGGCGGCCACGCAGATGGGTTT
TATGAGCCGCACGAAGGATGGCTCCGTGGATAATGCCAATGCCCTGCGCTTTGAGGACAAGGCGGGTGCA
GAGCAGGTGTGGATCCAGGCCGAGCGCAATCTGGATATTAACGTCAAAAACGACGAAACACATTCTACTG
AAAAAAATCGAACCCAGTTTGTTGGTGAAGATGAAACCTTACGGGTAGCGAAAAACCAGAAATCAGGGAT
TAAAGGCGATGTGGTATGCCTGACGGGGAACAGTCGAAACGATAAGGTCGTTAATAATTTTATACTTTCC
GCAGGAAATACACTGAGACTGGAATGTGGTGAAAGCGCCATCGAGCTATCAAAAGACGGTAGCGTTCATA
TCATTGGTAATAACTTTAACTTTACAGCAAAACAGAACGCACAAATTAATACGCTTTCCGGCGAATTGCA
CTTGAACCCTGATGACGGACGAAATGTCATCGATCCGCCTGGTGCATCCCTTCAGGGTGAAATCCAACAG
GAAGTGGATAGTTTTTTTGTTATTAATGGCAACAAGTAA