SecReT6
Protein ID: 365970971
SecReT6 ID514
T6SS typei3
Gene symbolclpV1
Locus tagEcWSU1_02679
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2768395..2771076 [-]
Productprotein ClpV1
NoteTssH
UniProt IDG8LFC7
KEGG IDeec:EcWSU1_02679
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.80E-41, Aligned region: 245..263
AAA_2 [PF07724], Evalue: 5.80E-41, Aligned region: 624..789
AAA [PF00004], Evalue: 1.80E-21, Aligned region: 158..179
AAA [PF00004], Evalue: 1.80E-21, Aligned region: 245..377
AAA [PF00004], Evalue: 1.80E-21, Aligned region: 630..714
AAA [PF00004], Evalue: 1.80E-21, Aligned region: 825..874
ClpB_D2-small [PF10431], Evalue: 1.80E-16, Aligned region: 797..869
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 245..323
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 629..748
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 55..102
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 222..267
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 290..323
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 494..546
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 626..674
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 797..816
AAA_22 [PF13401], Evalue: 8.40E-09, Aligned region: 245..331
AAA_22 [PF13401], Evalue: 8.40E-09, Aligned region: 389..411
AAA_22 [PF13401], Evalue: 8.40E-09, Aligned region: 628..660
AAA_22 [PF13401], Evalue: 8.40E-09, Aligned region: 690..712
Sigma54_activat [PF00158], Evalue: 1.40E-07, Aligned region: 227..325
Sigma54_activat [PF00158], Evalue: 1.40E-07, Aligned region: 629..745
AAA_14 [PF13173], Evalue: 9.10E-07, Aligned region: 79..100
AAA_14 [PF13173], Evalue: 9.10E-07, Aligned region: 245..326
AAA_14 [PF13173], Evalue: 9.10E-07, Aligned region: 628..739
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 244..269
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 298..342
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 500..532
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 626..654
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 244..268
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 627..651
AAA_18 [PF13238], Evalue: 1.50E-05, Aligned region: 245..265
AAA_18 [PF13238], Evalue: 1.50E-05, Aligned region: 631..658
AAA_18 [PF13238], Evalue: 1.50E-05, Aligned region: 819..878
IstB_IS21 [PF01695], Evalue: 1.50E-05, Aligned region: 231..267
IstB_IS21 [PF01695], Evalue: 1.50E-05, Aligned region: 629..657
IstB_IS21 [PF01695], Evalue: 1.50E-05, Aligned region: 740..762
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 245..307
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 629..665
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 244..265
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 622..679
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 802..838
NACHT [PF05729], Evalue: 0.0001, Aligned region: 245..272
NACHT [PF05729], Evalue: 0.0001, Aligned region: 302..345
NACHT [PF05729], Evalue: 0.0001, Aligned region: 630..661
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 50..97
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 138..145
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 332..342
Arch_ATPase [PF01637], Evalue: 0.0002, Aligned region: 223..259
Arch_ATPase [PF01637], Evalue: 0.0002, Aligned region: 298..329
Arch_ATPase [PF01637], Evalue: 0.0002, Aligned region: 628..668
AAA_29 [PF13555], Evalue: 0.00092, Aligned region: 237..260
AAA_29 [PF13555], Evalue: 0.00092, Aligned region: 627..654
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 246..266
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 630..651
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 727..748
SRP54 [PF00448], Evalue: 0.004, Aligned region: 244..265
SRP54 [PF00448], Evalue: 0.004, Aligned region: 628..665
Protein Sequence: 893 a.a.     [Download]
>gi|365970971|ref|YP_004952532.1| protein ClpV1 [Enterobacter cloacae EcWSU1]
MAIWCIAQSDNFSNALLSTEPNMSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQ
QDGDLQQVIRHFALDEQQLTRDIVAALDALPRGASSVSDLSEHIDSAVERAWVFGSLKYGVSRIRGGHLL
IGILKTWNLANVLKSISAQFTRLNVDVLIEQFDAICVQSKETQQAAAAADTPASTVPAAQGTLAQYGQDL
TARAREGKIDPVVGRDEEIRQMVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAEGDVPAPLQNIQLW
LLDIGMLQAGAGMKGEFEARLQALINEVQSSATPVILFIDEIHTLIGAGGQQGTGDAANLLKPALARGQL
RTIGATTWAEYKKYIEKDPALTRRFQTVQVHEPDEAKAILMLRSTVSPLESHHQVLLLDEAVSAAVKLSH
RYIPARQLPDKAVALLDTACARVAVSQSAPPAQLEDCLRHLAALDVEIEIAGREARVGAGDPERVAALTA
ERDTYETKREALTQRWEEERALVTEIIRLRAALFAAGDDETGELRSELNAQQQALNALQGDEPLLFAAVD
ENVVAAVVSDWTGIPLGRMVKNEIDAVLNLADTLNQRVIGQRHGLDLIARRVKTSRAKLDDPNKPVGVFM
LCGPSGVGKTETALALAESLYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYS
VVLLDEIEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTDLISAMCADPELMPEPEALS
GALRQPLLEVFPPALLGRLLVVPYYPLSDEMLGQIVRLQLKRIQRRLQENHNIISEFDDSVVEQIVQRCT
EVESGGRMVDAILTNTLLPQMSQILLTASRSDEQYRRLHVTCEQGEFHCQFAA
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2771076-2768395 Enterobacter cloacae EcWSU1 chromosome, complete genome
GTGGCGATCTGGTGTATCGCGCAGAGCGATAATTTTTCTAACGCATTGTTATCAACGGAACCGAACATGT
CAGAAATCAGCCGTGCCGTGCTTTTCGGCAAACTGGATACGCTGTTATTTACCTCACTGGAAAGCGCCAC
CGCGTTCTGCAAGCTGCGCGGCAACCCCTATGTTGAGCTGGTGCACTGGCTGCATCAGCTGATGCAGCAG
CAGGATGGCGATCTGCAACAGGTGATACGTCATTTTGCTCTCGATGAACAGCAGCTGACGCGCGATATCG
TGGCCGCACTGGATGCGCTGCCACGTGGCGCGAGTTCTGTTTCCGATCTGTCAGAACATATCGACAGCGC
CGTGGAGCGCGCGTGGGTGTTTGGCTCGCTGAAGTATGGCGTCAGCCGTATTCGCGGCGGACATTTGCTG
ATTGGCATCCTGAAAACCTGGAATCTGGCTAACGTGCTGAAAAGCATCTCGGCGCAGTTCACCCGCCTAA
ACGTCGACGTGCTGATCGAGCAGTTTGATGCGATTTGCGTTCAGAGCAAAGAGACGCAGCAGGCGGCCGC
TGCCGCGGATACGCCAGCCAGTACGGTGCCTGCCGCACAAGGGACGCTGGCCCAGTATGGTCAGGACCTG
ACCGCGCGCGCGCGTGAAGGGAAGATTGACCCGGTTGTCGGGCGCGATGAAGAGATCCGCCAGATGGTCG
ATATTCTGATGCGCCGTCGCCAGAATAACCCGTTGCTGACCGGGGAAGCTGGCGTTGGCAAAACGGCGGT
GGTGGAAGGGCTGGCGCTGCGTATCGCCGAAGGCGACGTGCCGGCACCGCTGCAGAATATTCAGCTTTGG
CTGCTGGATATCGGCATGCTGCAGGCCGGCGCAGGCATGAAAGGCGAGTTCGAAGCGCGTCTGCAGGCCC
TGATTAATGAAGTGCAGTCCAGCGCTACGCCAGTCATTCTGTTTATCGATGAGATCCACACCCTGATTGG
CGCAGGCGGTCAGCAGGGTACCGGTGATGCCGCTAACCTGCTCAAGCCGGCTCTGGCGCGCGGGCAACTG
CGCACCATCGGTGCCACCACCTGGGCGGAATACAAAAAATACATTGAGAAAGACCCGGCGCTGACCCGTC
GTTTCCAGACGGTACAGGTTCACGAGCCGGACGAAGCCAAAGCGATTCTGATGCTGCGCAGCACCGTGTC
ACCGCTGGAGTCGCATCACCAGGTACTGCTTCTCGACGAAGCGGTCAGCGCAGCGGTCAAGCTGTCACAT
CGTTATATTCCGGCGCGTCAGTTGCCGGATAAAGCCGTTGCGCTGCTTGATACTGCCTGTGCCCGCGTGG
CGGTCAGCCAGAGCGCGCCACCGGCACAGCTGGAAGATTGCCTGCGCCACCTCGCGGCCCTGGATGTGGA
GATCGAGATTGCCGGACGCGAAGCGCGCGTGGGTGCCGGCGATCCGGAGCGCGTCGCAGCCTTGACCGCC
GAGCGCGATACATACGAAACAAAGCGCGAAGCCCTGACCCAGCGCTGGGAAGAGGAACGTGCTCTTGTGA
CTGAAATCATCCGCCTGCGTGCCGCGCTGTTTGCCGCGGGTGATGACGAGACCGGCGAACTGCGCAGCGA
GCTTAACGCGCAGCAGCAGGCGCTCAACGCTTTACAGGGCGACGAGCCGCTGCTGTTTGCGGCGGTGGAT
GAAAACGTGGTGGCGGCGGTGGTCTCTGACTGGACCGGTATCCCGCTGGGCCGGATGGTGAAAAACGAGA
TTGATGCGGTGCTCAACCTGGCTGATACCCTCAACCAGCGCGTCATCGGCCAGCGTCACGGCCTGGATCT
GATTGCCCGCCGCGTGAAAACCTCGCGGGCAAAACTCGACGATCCGAACAAACCTGTTGGCGTATTTATG
CTCTGTGGACCGTCCGGCGTGGGGAAAACGGAAACCGCACTGGCGTTGGCGGAGTCGCTTTATGGTGGTG
AGCAGAACGTTATCACCATCAACATGAGTGAATTCCAGGAAGCCCACACCGTTTCGACCTTAAAAGGTGC
GCCTCCAGGATACGTGGGTTATGGTGAAGGCGGGGTATTAACCGAGGCCGTTCGCCGTCGCCCGTACAGC
GTGGTCTTGCTGGACGAAATTGAAAAAGCGCACCCTGATGTACATGAAATCTTCTTCCAGGTCTTCGATA
AAGGCTGGATGGAAGATGGCGAGGGCCGCCATATTGATTTCCGTAACACCATCATTATTCTGACGTCCAA
CGTCGGCACCGATTTGATCAGCGCCATGTGTGCCGATCCGGAACTGATGCCTGAGCCTGAGGCGTTAAGC
GGCGCGTTGCGTCAGCCGCTGCTGGAGGTCTTCCCGCCGGCGCTGCTGGGCCGTCTGCTGGTGGTGCCGT
ATTATCCACTGAGCGACGAGATGCTGGGGCAGATTGTCCGCCTGCAGCTCAAACGCATTCAGCGTCGTCT
GCAAGAGAATCACAATATTATTTCCGAGTTTGATGACAGCGTGGTGGAACAAATTGTTCAGCGCTGTACC
GAGGTGGAGTCTGGCGGCCGCATGGTGGACGCTATTCTGACAAACACCTTGCTGCCTCAGATGAGCCAGA
TATTACTTACCGCCAGCCGCAGCGATGAGCAGTACCGACGTCTGCACGTCACCTGTGAGCAGGGCGAGTT
TCACTGTCAGTTTGCCGCGTAA