SecReT6
Protein ID: 365970972
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02680
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2771045..2772088 [-]
Producthypothetical protein
NoteTssG
UniProt IDG8LFC8
KEGG IDeec:EcWSU1_02680
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-106, Aligned region: 27..330
Protein Sequence: 347 a.a.     [Download]
>gi|365970972|ref|YP_004952533.1| hypothetical protein EcWSU1_02680 [Enterobacter cloacae EcWSU1]
MSEVASAPLRVHRLTPLPDAFWRGVRETPWRYDLFQLLRRIDAQGGERYPLGRAPLPKFEPLRIGQQPSM
SFAPSTLAQVRQREENGLHEVSILSFGLFGPNGPLPVHMTEYARERIHHHQDTSLSAFADLFHHRLTLLF
YRAWADAQPAVSLDRADNKRFEGYLASLIGMGQPGQMTKGSLSAHARFTHAGHLTRHARDPEGLEKTLRN
YFHAPVKLVTNVAQWMPLSPREQAQLGEGRRLPRMGESAFLGVAVRDVQHKFRIEIGPLSADEYNRFLPG
EAWVTELRDWVRQYAGVEFEWETRVILRADAVQGASLGSAGRLGYNTWLGLQPQPVPRGDLVYRAER
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2772088-2771045 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGAGCGAAGTCGCCTCCGCGCCGCTGCGTGTCCATCGCCTGACGCCGTTGCCGGACGCTTTCTGGCGCG
GCGTTCGCGAGACGCCGTGGCGCTACGATCTGTTCCAGCTATTAAGACGCATTGATGCCCAGGGCGGTGA
ACGTTATCCGCTGGGGCGCGCGCCGCTGCCGAAATTTGAGCCGTTACGTATCGGTCAGCAGCCATCGATG
AGCTTTGCGCCGTCGACCCTCGCGCAGGTGCGCCAGCGTGAAGAGAACGGGCTGCACGAGGTGTCTATCC
TCAGCTTCGGTCTGTTTGGTCCAAATGGCCCGCTGCCTGTCCATATGACAGAGTACGCCCGGGAGCGTAT
TCATCATCATCAGGACACCAGCCTGAGCGCGTTTGCCGATCTGTTCCATCATCGCCTGACGCTGTTGTTT
TACCGTGCCTGGGCTGATGCGCAGCCCGCCGTCTCTCTTGACCGCGCGGACAATAAACGCTTTGAGGGGT
ATCTGGCATCCTTGATCGGCATGGGCCAGCCGGGGCAGATGACCAAAGGCAGCCTGAGCGCACATGCCCG
TTTTACTCACGCCGGACACCTGACTCGTCACGCCCGGGATCCGGAAGGGCTGGAGAAGACCCTGCGCAAC
TATTTTCACGCCCCGGTAAAACTGGTCACGAACGTGGCGCAGTGGATGCCGCTTTCGCCGCGGGAACAGG
CGCAGTTGGGTGAAGGGCGTCGTCTGCCGCGGATGGGAGAATCCGCTTTTCTCGGCGTTGCGGTGCGCGA
CGTGCAGCACAAGTTTCGTATCGAAATCGGCCCACTGAGCGCGGACGAGTACAACCGCTTCCTGCCAGGC
GAAGCGTGGGTCACTGAACTGCGCGACTGGGTACGCCAGTACGCAGGGGTAGAATTTGAATGGGAAACTC
GGGTTATTCTGCGCGCCGACGCGGTGCAGGGTGCCTCGCTCGGTAGCGCCGGGCGGTTAGGTTACAACAC
CTGGCTGGGCCTTCAACCTCAGCCTGTCCCACGTGGCGATCTGGTGTATCGCGCAGAGCGATAA