SecReT6
Protein ID: 365970973
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02681
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2772085..2773962 [-]
Producthypothetical protein
NoteTssF
UniProt IDG8LFC9
KEGG IDeec:EcWSU1_02681
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-209, Aligned region: 7..625
Protein Sequence: 625 a.a.     [Download]
>gi|365970973|ref|YP_004952534.1| hypothetical protein EcWSU1_02681 [Enterobacter cloacae EcWSU1]
MIMESKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYTERLMEGFAFLTSRVQMKMDAEF
PRFSQRLLEMIAPNYLAPTPSMAIAEIQPDSTRGDLSNGFKVPRGTMMDSLALKKTGVTCSYTTAHEVNL
LPLKIDKVELGGVPADLPLAQLGLSQRGINSALRIRIACDGPQHLGHLDFDRLEFFLSGPDIEALKLLEL
VMEHHAGIVCQTVSKHPQRQLLSADALRQEGFEPDQALLPDDLRNFDGYRLLQEYFAFPARFRFISLSGL
GKLIQHCENEKAFDIFILLDKSDEQLERVVDASHLAMHCTPVINLFPKVAARQKLSESQHEYHLVVDNIR
PLDYEIYAVNKIFGSADGQRDDQTFRPFWSTWSGDAGNYGAYFSLRREQRVLSEHALRYGTRTGYIGSEV
FVSLVDEQHAPWQENLRYISAEVLCTSRDLPLMLQQELGQFIMADSMPVKSLTLRKGPTPPRPALAEGFS
TWRLISQLQMNYLSLMDSENEEGAAALRQLLGLYANLAETPVARQVEGVRHCVLEPVHRRVPEPGPVVFA
RGIGITLTVDERAFSGASPWLFGSVLERLFARLVSINSFTEFTLKSQQRGEIGYWAPRMGKRALL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2773962-2772085 Enterobacter cloacae EcWSU1 chromosome, complete genome
GTGATCATGGAAAGTAAACTGCTCGAATATTACAACCGTGAACTGGCCTATCTGCGTGAAATGGGCGCTG
AATTTGCCGAGCGCTATCCCAAAGTTGCGGGTCGACTGGGCATGCGCGGCATCGAAGTGGCGGATCCGTA
TACAGAACGCCTGATGGAGGGGTTCGCGTTCCTGACCTCCCGCGTGCAAATGAAAATGGATGCGGAGTTC
CCGCGCTTCTCCCAGCGTTTGCTGGAAATGATTGCGCCAAACTATCTCGCGCCAACCCCCTCAATGGCAA
TTGCTGAAATCCAGCCCGACAGCACGCGTGGCGATCTGAGCAACGGTTTTAAGGTGCCGCGCGGCACCAT
GATGGACAGCCTGGCGCTGAAAAAGACCGGGGTCACCTGCAGCTACACCACGGCGCATGAAGTTAATCTG
CTGCCGCTGAAAATCGATAAGGTCGAGCTGGGCGGTGTGCCTGCCGATCTGCCGCTGGCGCAGCTGGGCC
TGAGCCAGCGGGGGATCAACAGCGCGTTACGGATCCGCATTGCCTGCGATGGCCCGCAGCATCTTGGGCA
TCTGGATTTTGACCGTCTGGAGTTTTTCCTTAGCGGCCCGGATATTGAAGCGCTCAAGCTGCTTGAGCTG
GTCATGGAGCACCACGCCGGGATTGTCTGCCAGACCGTCAGCAAGCACCCGCAGCGACAGCTGCTCTCTG
CGGATGCCTTGCGACAGGAAGGGTTTGAGCCGGACCAGGCGCTGCTTCCGGACGACCTGCGCAACTTTGA
CGGCTATCGTCTGCTGCAGGAATACTTTGCGTTTCCGGCACGGTTCCGCTTTATCAGCCTCAGCGGTCTG
GGCAAGCTTATCCAGCACTGTGAAAATGAAAAAGCGTTCGATATTTTCATCCTGCTGGATAAAAGCGATG
AGCAGCTGGAGCGGGTGGTTGATGCCAGCCATCTGGCGATGCATTGCACGCCGGTGATCAACCTTTTCCC
GAAAGTGGCGGCGCGGCAGAAGCTGAGTGAGAGCCAGCATGAATATCATCTGGTGGTGGATAACATCCGT
CCCCTGGATTATGAAATTTATGCGGTAAACAAAATCTTCGGCAGTGCCGACGGCCAGCGTGACGACCAGA
CGTTTCGTCCTTTCTGGAGCACCTGGAGCGGTGATGCGGGCAACTATGGCGCCTATTTTTCCCTGCGCCG
CGAGCAGCGAGTGCTCTCTGAACATGCCCTGCGCTACGGCACCCGCACCGGTTATATCGGCTCCGAAGTC
TTTGTTTCGCTGGTGGATGAACAGCATGCACCCTGGCAGGAAAATCTGCGCTATATCTCCGCGGAAGTAT
TGTGCACCAGCCGCGACCTGCCGCTGATGCTTCAGCAGGAACTCGGACAGTTCATCATGGCCGATTCCAT
GCCGGTGAAATCCCTGACCCTGCGAAAAGGCCCAACGCCGCCACGCCCGGCTCTGGCCGAAGGGTTTAGC
ACCTGGCGATTGATCAGCCAACTGCAGATGAACTATCTCAGCCTGATGGACAGCGAAAACGAAGAGGGTG
CCGCCGCCCTGCGTCAGCTGTTAGGGCTGTATGCTAACCTGGCGGAGACGCCGGTTGCGCGTCAGGTTGA
GGGCGTTCGCCACTGCGTGCTGGAGCCGGTTCACCGTCGCGTCCCGGAGCCGGGTCCGGTGGTCTTTGCG
CGTGGGATCGGCATTACTCTGACGGTGGATGAGCGTGCGTTTTCCGGCGCCAGCCCCTGGCTTTTCGGCA
GCGTGCTGGAACGCCTGTTTGCCCGCCTGGTGTCCATCAACAGCTTTACTGAATTCACGCTGAAGAGTCA
GCAGCGCGGTGAGATTGGCTACTGGGCACCGCGTATGGGGAAAAGGGCACTACTATGA