SecReT6
Protein ID: 365970975
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02683
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2773959..2774540 [-]
Producthypothetical protein
NoteTssE
UniProt IDG8LFD0
KEGG IDeec:EcWSU1_02683
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-18, Aligned region: 62..172
Protein Sequence: 193 a.a.     [Download]
>gi|365970975|ref|YP_004952535.1| hypothetical protein EcWSU1_02683 [Enterobacter cloacae EcWSU1]
MLRMEPMSNPAGEGDLLRSGWQARSKQEKVGARDKMQPSLLDRLTDNDPEKKRESANSNLITHAALRRNV
LRDLQWLFNTINHDASGDLSALPHVNRSVVNFGVAPLAGKRMSDIEWHDIQRKLTEAIINFEPRILPQGL
QVRCVSDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 582 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2774540-2773959 Enterobacter cloacae EcWSU1 chromosome, complete genome
TTGCTGCGGATGGAGCCCATGAGTAATCCCGCTGGCGAAGGCGATCTGCTGCGCAGCGGCTGGCAAGCCC
GCAGCAAGCAGGAGAAGGTGGGGGCGCGCGATAAAATGCAGCCCTCGCTGCTGGATCGCCTCACCGATAA
CGATCCGGAAAAAAAACGCGAGTCCGCCAACAGTAATCTGATTACCCACGCCGCCCTGCGCCGCAACGTG
CTGCGGGATCTGCAGTGGTTGTTTAACACCATCAACCATGACGCATCCGGCGACCTGAGCGCGTTGCCGC
ATGTGAACCGCTCGGTGGTTAATTTTGGCGTCGCGCCGCTGGCCGGGAAAAGAATGTCAGACATTGAATG
GCACGACATTCAGCGCAAGCTTACCGAGGCCATCATTAACTTTGAACCGCGTATTTTGCCGCAGGGACTG
CAGGTCCGCTGCGTGTCAGACACCTCGTCACTGGATCTGCACAACGTGTTGTCCATTGAGATAAAAGGGC
GTCTGTGGTGTGTGCCGTACCCGCTGGAGTTTCTGTTTCGCACCGATGTCGATCTGGAAAACGGCCATTT
TGAACTGAAAGATGCGGGGTGA