SecReT6
Protein ID: 365970976
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02684
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2774515..2775333 [-]
ProductVirulence protein SciE Type
NoteTagJ
UniProt IDG8LFD1
KEGG IDeec:EcWSU1_02684
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.50E-41, Aligned region: 142..265
TPR_19 [PF14559], Evalue: 0.0054, Aligned region: 14..70
TPR_19 [PF14559], Evalue: 0.0054, Aligned region: 78..120
Protein Sequence: 272 a.a.     [Download]
>gi|365970976|ref|YP_004952536.1| Virulence protein SciE Type [Enterobacter cloacae EcWSU1]
MAMNTLYQHLAGESLSDALVRLEAEIKARPADADLRAAFVQFLTLSGNWTRALTQLKSWLALKPQAKPTV
TLLEQSIQGELQRAQVMAGQARPAMPETQWPWLTTLAAALNDAGERAQALRLEALEQAQATAGQITLEND
ETQAFAWLMDGDARLGPVCETIVNGRYFWLPFNAIAEIRFQAPASVTDLVWRHALVRLTDGTEQVCQIPA
RYPFAADASDAVKLARTTEWLPLDNDGTLYEGMGQKAWLSEQSESPLLSLNLVTFAADGAHE
 
Nucleotide Sequence: 819 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2775333-2774515 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGGCTATGAATACGCTCTATCAACACCTGGCGGGTGAATCGCTGAGTGACGCGCTGGTGCGTCTTGAAG
CTGAGATCAAAGCCCGTCCGGCCGATGCCGATCTCCGCGCCGCGTTTGTGCAGTTTTTGACCCTCAGTGG
TAACTGGACGCGTGCCCTGACTCAGCTGAAAAGCTGGCTGGCACTTAAGCCCCAGGCTAAACCAACCGTT
ACCCTGCTGGAGCAGTCCATCCAGGGCGAGCTGCAGCGCGCGCAGGTGATGGCGGGGCAGGCTCGTCCTG
CCATGCCTGAAACGCAGTGGCCGTGGCTTACCACGCTTGCCGCCGCACTTAATGACGCGGGAGAGCGTGC
TCAGGCGCTGCGTCTGGAAGCCCTTGAGCAGGCGCAGGCAACGGCGGGGCAAATCACGCTTGAGAATGAC
GAGACGCAGGCATTCGCATGGCTGATGGACGGCGATGCTCGTCTGGGGCCCGTGTGTGAAACCATCGTCA
ACGGCCGTTATTTCTGGCTGCCGTTTAACGCCATCGCCGAGATCCGTTTCCAGGCGCCTGCCAGCGTGAC
TGACCTGGTGTGGCGTCATGCGCTGGTGCGCCTGACGGACGGTACCGAACAGGTTTGCCAGATCCCGGCA
CGCTATCCTTTCGCAGCGGATGCGTCTGACGCGGTTAAGCTCGCGCGCACCACCGAATGGCTGCCGCTCG
ACAATGACGGCACGCTGTATGAAGGCATGGGGCAGAAAGCCTGGCTTAGCGAGCAAAGCGAAAGCCCATT
GCTGTCGTTGAACCTGGTGACGTTTGCTGCGGATGGAGCCCATGAGTAA