SecReT6
Protein ID: 365970979
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02687
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2777134..2778918 [-]
ProductFHA Domain-Containing protein
NoteFha
UniProt IDG8LFD5
KEGG IDeec:EcWSU1_02687
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-09, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 28..49
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 78..99
Protein Sequence: 594 a.a.     [Download]
>gi|365970979|ref|YP_004952540.1| FHA Domain-Containing protein [Enterobacter cloacae EcWSU1]
MRFTIISTKPGHQPPQSSCDFYAPGGTIGRGTDNNLVLPDNDRTISRLQAIVHVDAQGECRVTNRGSVTR
VVLNDIPLERGRQVELQDGDILGIDDYRIEVTELIHDTQPVSRMAATMQQQARPAAAPAAAPQPKPASAA
PRGKAEPTAVPSEIWDSLMQEFSISDSISSSRAKPQPAASHDPFSQPVAPERNAEDPLAMFNDSDPKLER
KNVDPDTLFSDEALFKKESIFDDVTPSTLVPPNEAKPAQPQEEQTDELDPLALFGGSASAPAARNDDPLG
LMGGAPLTHPDEIVGDKPEAVVEPDLTPEPEAEQEEDVLAASPLFAPEPQVPPRVEEEEPARPDYAGFTM
PTPQAVARSNAQAPKGRLRIDPVKNAASPAAHNGEKGEVLQGELLEALLEGMGLSEMQPVPQFDRENMRQ
LGQILGMFSQGTVALLSSRSILKRGVKADMTMVLDDANNPFKLLPTGKTVLIQMFGTPMPGFMPPTKSVR
DALIDLQAHQLGMISGIRAIIAAMLQSFNPEQLEEQAKQNGMTSRLALPGSRKAALWDYFVRSYGETAGE
IEDDFHTLFGEAFLHAYDMEVNQYKDSQSGSEEK
 
Nucleotide Sequence: 1785 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2778918-2777134 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGCGATTCACGATTATTTCTACAAAACCCGGTCATCAGCCGCCGCAGAGCAGCTGTGATTTTTATGCCC
CGGGCGGCACCATTGGGCGCGGTACGGATAACAATCTGGTATTGCCGGACAATGACCGCACCATCTCGCG
TTTGCAGGCCATTGTTCACGTTGACGCCCAGGGCGAATGCCGCGTCACTAACCGTGGCAGCGTCACCCGC
GTGGTATTGAATGACATTCCGCTTGAGCGCGGGCGCCAGGTTGAGCTGCAGGATGGGGACATTCTCGGTA
TTGATGATTACCGCATCGAAGTGACCGAACTGATTCATGATACGCAGCCAGTCAGCCGCATGGCGGCGAC
CATGCAGCAGCAGGCGCGTCCAGCCGCGGCCCCTGCGGCAGCCCCGCAGCCGAAGCCCGCGAGCGCCGCC
CCGCGCGGGAAGGCGGAACCGACTGCTGTGCCGTCGGAAATCTGGGATAGCCTGATGCAGGAGTTCTCTA
TCTCCGACAGCATTTCCAGTTCTCGGGCGAAGCCGCAGCCGGCAGCGTCGCACGATCCGTTCTCCCAGCC
TGTCGCACCTGAGCGTAACGCTGAAGATCCGCTGGCGATGTTCAATGACAGCGATCCAAAGCTTGAGCGT
AAGAACGTGGATCCGGATACGCTGTTCAGTGACGAAGCATTGTTCAAAAAAGAGAGCATTTTTGACGACG
TCACCCCGTCTACGCTGGTGCCGCCCAATGAAGCTAAACCTGCGCAGCCACAAGAAGAGCAGACGGATGA
ACTCGATCCGCTGGCTCTGTTTGGCGGTAGTGCCAGCGCACCTGCTGCACGAAATGATGATCCCCTCGGG
TTGATGGGCGGGGCACCGTTAACCCATCCGGATGAAATTGTCGGCGATAAGCCAGAGGCCGTCGTTGAGC
CAGACCTGACGCCAGAGCCGGAAGCAGAACAGGAAGAGGACGTCCTTGCCGCTTCTCCGCTGTTTGCTCC
TGAGCCGCAGGTGCCGCCGCGCGTGGAAGAAGAAGAGCCGGCGCGACCGGATTATGCCGGCTTCACCATG
CCAACCCCGCAGGCCGTAGCGCGCAGTAATGCCCAGGCACCTAAAGGGCGTTTGCGTATTGACCCGGTCA
AAAACGCGGCGTCGCCAGCAGCCCATAATGGCGAAAAGGGTGAAGTACTGCAGGGCGAATTACTTGAGGC
ACTGCTGGAAGGGATGGGGCTCAGCGAAATGCAGCCCGTCCCGCAGTTTGACCGTGAAAATATGCGTCAG
CTGGGGCAAATTCTGGGCATGTTCTCTCAGGGCACCGTGGCGCTGCTTTCTTCGCGCTCCATTCTCAAGC
GCGGCGTAAAAGCCGATATGACCATGGTACTTGATGATGCCAACAACCCGTTCAAACTGTTGCCGACCGG
GAAAACCGTTCTGATCCAGATGTTCGGTACGCCAATGCCGGGCTTTATGCCGCCGACAAAATCCGTGCGT
GACGCGCTGATCGATCTGCAGGCGCATCAGCTGGGTATGATCTCCGGTATCCGCGCCATCATTGCCGCCA
TGCTGCAATCCTTCAACCCGGAACAGCTGGAAGAGCAGGCGAAGCAGAACGGGATGACCTCCCGACTGGC
GCTACCGGGCAGTCGCAAAGCCGCGCTGTGGGACTACTTTGTCCGCAGCTATGGTGAAACGGCAGGCGAG
ATTGAGGATGACTTCCACACCCTGTTTGGCGAAGCCTTCCTTCATGCTTATGACATGGAGGTAAATCAGT
ACAAAGACTCACAGAGCGGATCGGAAGAAAAATGA