SecReT6
Protein ID: 365970982
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02690
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2782152..2783651 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8LFD8
KEGG IDeec:EcWSU1_02690
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|365970982|ref|YP_004952543.1| hypothetical protein EcWSU1_02690 [Enterobacter cloacae EcWSU1]
MSNQTQQHEQQSGQAFSQDEFSALLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSSDTYRTIQNLI
AGIDEQLSQQVNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQS
PIFKKIYEQEYGQFGGEPFGCIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHNSYSWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFREREEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKTKDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2783651-2782152 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGAGCAACCAGACTCAACAACACGAGCAGCAGAGTGGTCAGGCGTTCAGCCAGGATGAATTCAGCGCGC
TGCTGAACAAAGAGTTCCGCCCGAAAACCGATCAGGCGCGCTCCGCGGTGGAAAGCGCGGTAAAAACGCT
GGCGCAGCAGGCACTGGAAAATACCGTTACCTTCTCCAGTGACACCTACCGCACCATTCAGAACCTGATT
GCCGGCATCGACGAGCAGCTGTCTCAGCAGGTGAACCAGATTATTCACCATGAAGAGTTCCAGAAGCTGG
AGAGCGCCTGGCGCGGTCTGAGCTACCTGGTGAACAACACTGAAACCGACGAGATGCTGAAGATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGTCGTACCCTGAAACGCTTTAAGGGCGTGGGCTGGGACCAGAGC
CCAATCTTCAAGAAAATCTACGAGCAGGAGTACGGTCAGTTTGGTGGCGAGCCGTTTGGCTGCATCGTCG
GCGACTACTACTTCGACCACAGTCCGCAGGACGTTGAACTGCTGGGCGAGATGGCGCGTATCGGCTCGGC
GGCCCACTGTCCGTTTATCACCGGTACCGCACCGGGCGTGATGCAGATGGAGTCCTGGCAGGAACTCGCG
AACCCGCGCGACCTGACCAAAATCTTCCAGAACACCGAGTATGCCGCGTGGCGTTCACTGCGTGAATCCG
AAGATGCACGCTACCTTGGCCTGGTGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGTATTCGCACTAA
CCCGGTCGACAGCTTCGATTTCGAAGAGCAGACCGATGGCGCGAACCACAATAGCTACTCCTGGGCGAAC
GCCGCGTATGCCATGGCTGCCAACATCAACCGCTCCTTTAAAGAGTACGGCTGGTGTACCTCAATCCGCG
GCGTGGAGTCCGGCGGGGCGGTTGAAAACCTGCCATGTCACACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAATGCCCGACCGAGATCGCCATCAGCGATCGCCGTGAAGCCGAGCTGGCGAAGAACGGCTTTATG
CCGCTGGTTCACCGCAAAAACTCTGACTTTGCCGCCTTCATCGGCGCGCAGTCTCTGCAGAAACCGGCTG
AGTACCACGACCCGGATGCGACCGCTAACGCGCGTCTGGCATCCCGTCTGCCGTACCTGTTCGCCTGCTG
CCGCTTTGCCCACTACCTGAAGTGCATCGTGCGCGACAAAATTGGCTCCTTCCGTGAACGTGAAGAGATG
GAACGCTGGCTGAACGACTGGGTGATGAACTATGTGGACGGTGACCCGGCTAACTCCTCACAGGAGACCA
AGTCCCGTAAACCGCTGGCAGCTGCCGAAGTGCAGGTGCAGGAAATTGAAGATAACCCGGGCTACTACGC
CGCGAAATTCTTCCTGCGTCCACACTACCAGCTGGAAGGTCTGACCGTTTCTCTGCGTCTGGTTTCGAAA
CTGCCGTCACTGAAGACGAAAGACGCGTGA