SecReT6
Protein ID: 365970983
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02691
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2783655..2784194 [-]
Producthypothetical protein
NoteTssB
UniProt IDG8LFD9
KEGG IDeec:EcWSU1_02691
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.60E-61, Aligned region: 16..167
Protein Sequence: 179 a.a.     [Download]
>gi|365970983|ref|YP_004952544.1| hypothetical protein EcWSU1_02691 [Enterobacter cloacae EcWSU1]
MMENIMAMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVENLPAVDERKFLEI
DIDNFDERMKALKPRVAFQVDNTLTGEGKLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTY
MDGKNGAEELIAKILQDPTLLKSLSQLPKNDESAKGSEE
 
Nucleotide Sequence: 540 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2784194-2783655 Enterobacter cloacae EcWSU1 chromosome, complete genome
TTGATGGAGAACATCATGGCAATGAGTAACAGTGGGCAGAAATTCATCGCACGTAACCGTGCCCCCCGCG
TGCAGATCGAGTACGACGTAGAGATCTACGGTGCAGAACGTAAAATTCAGCTGCCGTTTGTGATGGGCGT
CATGGCCGATCTGGTCGGCAAACCGGTGGAAAACCTGCCGGCAGTCGATGAGCGTAAATTCCTCGAAATC
GACATTGATAACTTTGACGAGCGCATGAAAGCGCTGAAACCTCGCGTGGCGTTCCAGGTGGATAACACGC
TGACCGGCGAAGGTAAGCTCAACGTTGATCTCACCTTCGACAGCATGGACGACTTCCTGCCGGACGCGGT
AGCCCGCAAGGTTGAACCGTTGAACAAGCTGCTGGAAGCACGTACTCAACTCTCCAACCTGCTGACCTAT
ATGGATGGCAAAAACGGCGCGGAAGAGCTGATCGCTAAAATTCTGCAGGATCCGACGCTGCTCAAATCTC
TGAGCCAGTTGCCGAAAAATGACGAAAGCGCGAAAGGTAGCGAGGAATAA