SecReT6
Protein ID: 365970984
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02692
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2784255..2785271 [-]
Producthypothetical protein
NoteTssA
UniProt IDG8LFE0
KEGG IDeec:EcWSU1_02692
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-19, Aligned region: 52..111
Protein Sequence: 338 a.a.     [Download]
>gi|365970984|ref|YP_004952545.1| hypothetical protein EcWSU1_02692 [Enterobacter cloacae EcWSU1]
MNIEEFLAPISPDKPCGENLEYDADFQLMNQASQGKAEQQFGDTIIPAEPADWNTVEKFATSLLSRTKDL
RVMLALTHAWTRRRGLAGYADGLLLVQEAITRYWEPLYPLLEEYGETDPFYRINALAGLSDKSDLTVAVR
NASLLRSNGDEISLRDAQALLDGSKNECPDYPGGRPRLIDELARGDQPGTSAVIVINERLLAIRELLTGH
LGESGVPEMEQLLKTVGLVASACQVTDISKLLPNREAQAELSAEPQPAVAQPVQQVTDWRSVQVTSRADA
QLMLEKAKQYFAQYEPSHPAPLMIERVQRLSELNFMDIIRDLAPDGVNQLENIFGRRE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2785271-2784255 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGAATATCGAAGAATTTCTCGCGCCAATAAGCCCCGACAAGCCCTGTGGCGAAAACCTGGAGTATGACG
CTGATTTCCAGCTCATGAATCAGGCCAGCCAGGGCAAAGCAGAGCAGCAGTTTGGCGACACCATCATTCC
GGCAGAACCTGCTGACTGGAATACGGTGGAAAAATTCGCCACCAGCCTGCTGAGCCGCACCAAAGATCTG
CGCGTCATGCTGGCGTTAACGCATGCATGGACACGTCGCCGCGGCCTTGCGGGCTACGCCGACGGGCTGT
TACTGGTGCAGGAGGCGATCACGCGTTACTGGGAGCCGCTCTATCCGCTGCTGGAAGAGTATGGCGAAAC
CGACCCGTTTTACCGCATTAACGCCCTGGCCGGGCTGAGTGATAAGTCTGACCTGACCGTCGCCGTGCGT
AACGCCTCGCTGCTGCGATCAAATGGCGATGAAATTTCACTTCGCGACGCTCAGGCACTGCTGGATGGCA
GTAAAAACGAATGTCCGGATTACCCCGGTGGCCGTCCAAGACTGATTGACGAGCTGGCCCGCGGCGATCA
GCCGGGCACGTCGGCGGTGATAGTGATTAACGAACGGCTGCTGGCCATTCGTGAGTTGCTCACCGGCCAT
CTTGGTGAAAGCGGCGTTCCGGAGATGGAACAGCTGCTGAAAACCGTCGGGCTGGTCGCCAGCGCCTGTC
AGGTGACCGACATCAGCAAGCTGCTGCCCAACCGGGAGGCACAGGCTGAGCTCAGCGCTGAACCTCAACC
GGCGGTCGCACAACCCGTTCAGCAGGTTACAGACTGGCGCAGCGTGCAGGTCACCAGCCGCGCCGATGCA
CAGCTGATGCTGGAGAAAGCCAAACAGTATTTTGCGCAGTACGAACCGAGCCACCCCGCACCGTTGATGA
TTGAACGGGTGCAGCGGCTGTCAGAACTTAACTTTATGGACATTATTCGCGACCTGGCGCCAGACGGCGT
TAACCAACTGGAAAACATCTTTGGACGCCGCGAATAA