SecReT6
Protein ID: 365970987
SecReT6 ID514
T6SS typei3
Gene symbolytxE
Locus tagEcWSU1_02695
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2789639..2790877 [-]
Productprotein YtxE
NoteTssL
UniProt IDG8LG35
KEGG IDeec:EcWSU1_02695
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-69, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 4.60E-69, Aligned region: 369..389
OmpA [PF00691], Evalue: 2.10E-14, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|365970987|ref|YP_004952548.1| protein YtxE [Enterobacter cloacae EcWSU1]
MQERQDTGSDAAFTGASSNNQLVAAANPLLNAIPQIRHSVSHDDQVALRQRLIDEIRRFEVRCQQAGLAY
EVIVGARYCLCTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMIN
YCLLLGFEGRYRVLDNGRTQLETIKQRLWQMIRGVRGSYPPQLSPHPEDRPVLRKLWRPMVPLWACVALA
GFIACLFYIVLNWRLGDSTNPVLAKIYQSQLPETTIQQPARQLPAVLNLRGFLKPEIEAGLVAVKDEADR
SVVILKGDGLFASASTVVRDRYEPVINRIAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLERARSV
QKMLQGSLSQPERVKAEGRGEINPVAPNNTPENRARNRRVEITLLVSPENTQAELNGLPQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2790877-2789639 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGCAGGAACGACAGGATACCGGCAGTGATGCCGCGTTTACCGGAGCCAGTAGCAACAATCAGCTGGTGG
CGGCCGCCAATCCGCTGCTCAATGCGATTCCGCAAATCCGTCATTCGGTATCACATGACGATCAGGTGGC
GTTGCGCCAGCGCCTGATCGATGAGATCCGCCGGTTCGAAGTGCGCTGTCAGCAGGCCGGTCTGGCCTAT
GAGGTGATCGTCGGGGCACGTTACTGCCTGTGTACGGCACTTGATGAGGCCGCCGCGCTCACCCCCTGGG
GCAGCAGCGGCGTCTGGTCCAGCAATGGTCTGCTGGTGACGTTTCATAACGAAACCTGGGGTGGCGAAAA
GTTCTTCCAGCTGCTGGCGCGTCTGTCGCAAAACCCGCGCGAACATATTCTGCTGCTGGAGATGATCAAC
TACTGCCTGCTGCTCGGCTTCGAGGGGCGCTATCGGGTGCTGGATAATGGCCGCACCCAGCTTGAAACCA
TCAAGCAACGGCTGTGGCAGATGATTCGCGGCGTGCGTGGCAGTTACCCGCCACAGCTCTCTCCGCATCC
GGAAGATCGTCCGGTACTGCGCAAGCTATGGCGACCCATGGTACCTCTGTGGGCCTGTGTGGCGCTGGCC
GGGTTTATCGCCTGCCTGTTCTATATCGTGCTTAACTGGCGGCTTGGCGATAGTACCAACCCGGTATTAG
CAAAAATTTATCAGTCACAGCTTCCCGAAACGACTATCCAGCAACCTGCCCGCCAGCTGCCTGCGGTGCT
GAACCTGCGTGGTTTCCTGAAGCCGGAAATTGAAGCCGGTCTGGTTGCGGTAAAAGATGAAGCGGACCGT
AGCGTGGTGATCCTGAAAGGGGACGGCCTGTTTGCTTCCGCCTCAACCGTGGTACGTGACCGTTATGAGC
CGGTGATAAACCGTATTGCACAGGCCATGAATAACGTCAGCGGTAAAATTCTGGTGGTGGGCTACAGCGA
CAACGTGCCAATTCGCAGCGCGCGCTTTGCCTCTAACTATGAACTGTCGCTGGAACGTGCCCGGTCAGTT
CAGAAAATGCTGCAGGGAAGCCTCTCTCAACCTGAACGTGTGAAAGCGGAAGGCCGCGGCGAGATTAATC
CAGTGGCACCTAACAATACGCCGGAAAACCGTGCCCGTAACCGCCGGGTGGAAATTACTCTGCTGGTGTC
GCCTGAAAATACCCAGGCTGAGCTGAACGGATTGCCGCAAGGAAACTAA