SecReT6
Protein ID: 365970988
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02696
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2790895..2792292 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8LG36
KEGG IDeec:EcWSU1_02696
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-136, Aligned region: 37..461
Protein Sequence: 465 a.a.     [Download]
>gi|365970988|ref|YP_004952549.1| hypothetical protein EcWSU1_02696 [Enterobacter cloacae EcWSU1]
MASGSSASNALHNRNYIIMTKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDVELDE
AMLRQGCIALSYCSGLLPDGTFFQVRNGRNGPVPLKIPDNLTNEKVVLALPVRRGEREEVIFSEEPASLA
RFIAFEQEVEDDNAMSVGDATVQFGRLRLTLMLEKDVTAEWTAIGVAFVTEKRNDNHVRLDSSYIPPMLN
ANNSPQIYSMINDLHGLLVQRSQQIGGRLRQPGRFNTSELIEFTLLSLVNRHLGEVSHLKTLPLLHPETL
WRSWLPFATELATWASQRTAESVLPIYDHDDLAGCFSKLMMLLRQGLSLVMEDHAIQLPLNERSHGLNIA
TVPETSMVREFGFVLAVKANVPGEHLQTHFPAQMKVAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAG
YSYFELEKGSELWHEMDKSGAFALHLAGEFPGLDMEFWAIRSPTE
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2792292-2790895 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGGCATCCGGGTCATCAGCCAGTAACGCGCTTCATAACAGGAATTACATCATCATGACGAAAGCAGAAA
AGGTCGTCTGGACCGAAGGCATGTTCCTGCGCCCACACCATTTTCAGCGGACTGAAAGCTATCTGCTCAA
CCACGTTCGTGAATGGGGTGCGCTGCAGCGTTCATACCTTTGGGGCTTTCTCGACGTTGAGCTGGACGAA
GCGATGCTGCGCCAGGGATGCATTGCCCTGAGCTACTGCAGTGGACTGCTGCCTGACGGAACCTTTTTCC
AGGTGCGCAATGGCCGCAATGGTCCGGTGCCGCTGAAAATCCCTGACAATCTCACCAATGAAAAGGTGGT
GCTCGCACTGCCGGTTCGCCGTGGAGAGAGAGAAGAGGTGATCTTCAGTGAAGAGCCGGCCTCGCTGGCG
CGCTTCATCGCCTTTGAGCAAGAGGTGGAAGACGACAACGCCATGTCGGTAGGCGATGCCACCGTACAGT
TTGGCCGCCTGCGTCTGACCCTGATGCTGGAAAAAGATGTAACGGCAGAGTGGACCGCTATCGGTGTGGC
GTTTGTGACCGAGAAACGCAACGATAACCACGTGCGTCTCGATAGCAGCTACATTCCGCCGATGCTGAAT
GCCAATAACAGCCCGCAGATCTACAGCATGATTAACGATCTGCACGGCTTACTGGTGCAGCGCAGCCAGC
AAATTGGCGGTCGTCTGCGCCAGCCTGGCCGCTTTAATACCTCGGAACTGATTGAATTCACGCTGCTCTC
ACTGGTGAACCGCCATCTGGGAGAGGTTTCGCATTTAAAAACGCTTCCGCTGCTGCATCCGGAAACGCTC
TGGCGCAGCTGGCTGCCGTTTGCGACCGAGCTCGCCACCTGGGCGTCTCAGCGTACCGCTGAAAGCGTGC
TGCCAATTTACGATCACGACGACCTCGCGGGTTGCTTCAGCAAACTGATGATGCTGCTGCGTCAGGGGCT
GTCTCTGGTGATGGAAGACCATGCCATTCAGCTGCCGCTTAACGAGCGTTCCCACGGTCTGAACATCGCG
ACCGTGCCGGAAACCAGCATGGTGCGTGAGTTCGGTTTCGTGCTGGCGGTCAAAGCCAACGTGCCGGGCG
AACACCTGCAAACCCATTTCCCTGCCCAGATGAAAGTGGCGCCAGTCTCGAAAATTCGCGATCTGGTTCA
GCTGCAACTGCCTGGCATTATGCTGCGCGCCATGCCGGTCGCACCGCCGCAGATCCCCTGGCATGCAGGC
TACAGCTACTTCGAACTGGAGAAGGGGAGCGAGCTGTGGCACGAGATGGATAAGTCCGGCGCTTTCGCCC
TGCATCTCGCAGGCGAGTTCCCGGGACTTGATATGGAGTTTTGGGCCATCCGTAGCCCGACTGAATAA