SecReT6
Protein ID: 365970989
SecReT6 ID514
T6SS typei3
Gene symbolvasD
Locus tagEcWSU1_02697
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2792267..2792770 [-]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDG8LG37
KEGG IDeec:EcWSU1_02697
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.70E-30, Aligned region: 19..149
Protein Sequence: 167 a.a.     [Download]
>gi|365970989|ref|YP_004952550.1| type VI secretion system protein VasD [Enterobacter cloacae EcWSU1]
MNNKNFHWLWSVFYAAIFALVSGCTSSSHSDPSRYNLQFQAHPQINESAPLKVRVLLLKSDADFMSSDFY
SLQNNASATLGANLLNSDVFFLMPGQLSKTLSGQSSPDARYIGVMAEYQMLDGKKWRVSLPLPVPGENHI
YQFWKWSADELQANVFLDVNGIRVISQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2792770-2792267 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGAATAATAAAAATTTTCATTGGTTGTGGTCCGTCTTTTACGCGGCGATTTTCGCCCTTGTCAGTGGTT
GTACGTCGTCTTCACACAGCGACCCTTCCCGCTACAATCTGCAGTTTCAGGCTCATCCACAAATCAATGA
ATCTGCGCCGCTAAAAGTCAGAGTGCTGTTGCTGAAATCCGATGCGGATTTCATGTCCAGCGACTTCTAT
TCCCTGCAGAACAACGCGTCAGCCACGCTTGGCGCGAATCTGCTGAACAGCGATGTTTTCTTCCTGATGC
CGGGTCAGCTCTCGAAAACCCTGAGTGGACAGAGCTCTCCCGACGCCCGCTACATTGGTGTGATGGCGGA
ATATCAGATGCTGGATGGCAAAAAATGGCGCGTTTCACTCCCTCTGCCTGTGCCAGGCGAAAACCATATC
TACCAGTTCTGGAAATGGTCAGCGGATGAACTCCAGGCCAACGTGTTTCTCGACGTGAATGGCATCCGGG
TCATCAGCCAGTAA