SecReT6
Protein ID: 374291536
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1000
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]929220..930746 [-]
Producthypothetical protein
NoteTssL
UniProt IDG7Z5V8
KEGG IDali:AZOLI_1000
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-66, Aligned region: 120..324
OmpA [PF00691], Evalue: 1.10E-14, Aligned region: 401..500
Protein Sequence: 508 a.a.     [Download]
>gi|374291536|ref|YP_005038571.1| hypothetical protein AZOLI_1000 [Azospirillum lipoferum 4B]
MTVRPPPDKNPFEEPDDIDATVMQPMAFQRPAAPPAAPTAAPASPPPFSGGSAGLVPPAFGQSAQPFSAP
SAFSPAAFNTPKPAAPQAPAPAPAMSAPLSPGFRPLDDAALTALTAVSDNPLVTAAAPILAMVVRVRELT
QHRDVESLRERVIAEMQRFEAATVRAGLSATQIRNAGYALCATVDDVVLATSWGNQSLWAHKSLVSTIQK
ETWGGERFFDLLDQMAEVPDRHLMELELFYLCLSLGFEGKFRVSQRGYSELAKLRDRLYRVIRKQRGEAE
RDLSPHWRGQADGFRPLAATVPLWLPAVMIAALLAALYAWFIFALADQSDAAYRRLAAVIPDQPVQIARI
APPVTLPTPPPRQSVADRVALALAADIKAGLVEVSGGTDGRVLVRTRLNVFASGSDRIDPRYVEVFRHVA
EALRKEPGRISVIGNTDNVAIRSLRYPSNQELSEARAFRVQQLMTEILAGDAANRLSAEGRGDTDPIAPN
TTAEGRQANRRVDIVLAP
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c930746-929220 Azospirillum lipoferum 4B, complete genome
ATGACCGTCCGGCCGCCGCCCGACAAGAACCCGTTCGAGGAGCCGGACGACATCGATGCCACGGTGATGC
AGCCGATGGCGTTCCAGCGCCCGGCCGCACCCCCTGCCGCTCCCACTGCGGCGCCCGCCTCTCCGCCGCC
CTTCTCCGGCGGGTCGGCCGGGCTGGTGCCGCCGGCCTTCGGCCAGAGCGCGCAACCCTTCTCCGCCCCC
TCCGCCTTCTCGCCCGCCGCCTTCAACACGCCGAAGCCGGCAGCCCCGCAAGCCCCGGCACCCGCGCCCG
CGATGTCGGCCCCGCTCTCGCCCGGCTTCCGCCCGCTGGACGATGCGGCGCTGACGGCCCTGACCGCGGT
CAGCGACAACCCTCTGGTGACCGCCGCGGCGCCCATCCTGGCGATGGTGGTGCGGGTGCGCGAGCTGACG
CAGCACCGCGACGTGGAATCCTTACGCGAACGCGTCATCGCCGAGATGCAGCGGTTCGAGGCGGCCACCG
TCCGCGCCGGCCTGTCCGCCACCCAGATCCGCAACGCCGGCTACGCGCTGTGCGCGACGGTGGACGACGT
GGTGCTGGCGACCTCCTGGGGAAACCAGAGCCTGTGGGCGCACAAAAGCCTCGTCTCCACCATCCAGAAG
GAGACCTGGGGCGGCGAGCGCTTCTTCGACCTGCTCGACCAGATGGCGGAGGTGCCGGACCGCCACCTGA
TGGAGCTGGAGCTGTTCTACCTCTGCCTGTCGTTGGGCTTCGAGGGCAAGTTCCGGGTCTCGCAGCGCGG
CTACAGCGAGTTGGCGAAGCTGCGCGACCGGCTCTACCGCGTCATCCGCAAGCAGCGCGGCGAGGCGGAG
CGCGACCTGTCGCCCCACTGGCGCGGACAGGCCGACGGCTTCCGGCCGCTGGCGGCAACGGTGCCGCTGT
GGCTGCCCGCCGTGATGATCGCGGCGCTCCTGGCCGCCCTCTACGCCTGGTTCATCTTCGCCCTGGCCGA
CCAGTCCGACGCTGCCTATCGCCGGCTGGCCGCGGTGATCCCGGATCAGCCGGTGCAGATCGCCCGCATT
GCGCCGCCGGTCACCCTTCCCACCCCGCCGCCCCGCCAGTCCGTCGCCGACCGCGTCGCCCTGGCGCTTG
CCGCCGACATCAAGGCAGGTCTGGTCGAGGTCAGCGGCGGCACCGACGGGCGCGTGCTGGTCCGCACCCG
CCTGAACGTCTTCGCCTCGGGCAGCGACCGGATCGATCCGCGCTATGTCGAGGTGTTCAGGCATGTCGCC
GAGGCGCTGCGCAAGGAGCCGGGCCGCATCTCCGTGATCGGCAACACCGACAATGTCGCCATCCGCTCGC
TGCGCTATCCCTCCAACCAGGAATTGTCGGAGGCGCGGGCCTTCAGGGTGCAACAGCTGATGACGGAGAT
CCTGGCAGGCGATGCCGCCAACCGTTTGAGCGCCGAAGGGCGCGGCGACACCGATCCCATCGCCCCCAAC
ACGACGGCGGAGGGCCGGCAGGCCAACCGGCGCGTCGACATCGTGCTGGCACCCTGA