SecReT6
Protein ID: 374291537
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1001
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]930743..931426 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG7Z4I9
KEGG IDali:AZOLI_1001
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-34, Aligned region: 25..158
Protein Sequence: 227 a.a.     [Download]
>gi|374291537|ref|YP_005038572.1| hypothetical protein AZOLI_1001 [Azospirillum lipoferum 4B]
MLRIAGWMRIRKTIWSAAVLAAMPALAACSSPPPPPPPTTIQLTVIGAKALNPDPNGRPSPVMLRLYQLG
PSDAFANADFFQVIDQDKATLGPTLLDRQELAVPPDSRQTLTVQPKPDVKTLAVAAAFRAYEEAGWRAMQ
PIQPNKANSFVLTATASTVTLVPGDGSNASTDAPADKPADAKTEGAKTGASKQDAEKPATEKPDAAPKPA
ADQPPAATHNLILKGAS
 
Nucleotide Sequence: 684 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c931426-930743 Azospirillum lipoferum 4B, complete genome
ATGCTGAGGATTGCCGGCTGGATGCGGATCCGGAAGACGATTTGGTCCGCTGCCGTCCTGGCCGCAATGC
CGGCGCTTGCCGCCTGCTCCTCCCCGCCGCCGCCCCCGCCGCCGACCACGATTCAGCTGACGGTAATCGG
GGCCAAGGCGTTGAACCCCGACCCCAACGGCCGGCCGTCGCCGGTGATGCTGCGGCTCTATCAGCTCGGC
CCCAGCGACGCCTTCGCCAACGCCGATTTCTTCCAGGTCATCGACCAGGACAAGGCGACGCTCGGCCCCA
CCCTGCTCGACCGCCAGGAACTGGCTGTGCCGCCCGACAGCCGCCAGACCCTGACCGTCCAGCCCAAGCC
GGACGTCAAGACGCTGGCCGTCGCCGCCGCCTTCCGCGCCTATGAGGAAGCGGGCTGGCGCGCCATGCAG
CCGATCCAGCCGAACAAGGCCAACAGCTTCGTCCTGACCGCCACGGCCAGCACCGTCACGCTCGTCCCCG
GCGACGGCAGTAACGCCAGCACCGACGCCCCGGCGGACAAGCCTGCGGACGCCAAGACGGAGGGTGCGAA
GACCGGGGCCTCCAAGCAGGATGCCGAAAAGCCGGCCACGGAGAAACCGGACGCCGCGCCGAAGCCCGCC
GCCGACCAGCCGCCCGCTGCAACGCACAACCTGATCCTGAAGGGGGCGTCATGA