SecReT6
Protein ID: 374291540
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1004
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]934133..935218 [-]
Producthypothetical protein
NoteTssG
UniProt IDG7Z5V9
KEGG IDali:AZOLI_1004
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-101, Aligned region: 18..342
Protein Sequence: 361 a.a.     [Download]
>gi|374291540|ref|YP_005038575.1| hypothetical protein AZOLI_1004 [Azospirillum lipoferum 4B]
MARPRRQPPASVIDRLFRAPHRFDFFQAVRVLEWQARRDARDPRNTRRHAVGHDHDPREEVVRLRAETSL
TFPGNQVAGAEPGVDGRPPTLVGAFLGLVGPLGVLPQHYTELMIRSLRERNRALRDFFDVFHHRSFSLFY
RAWAKYRLPVSFERGQGSREPDPVSTTLSSFVGIGQPSLTKRLVVEDETLLHYSGLMSRGTRSANDLQEM
LSDFLGRPVTVESFVGGWLPIAPDGQTRLPSLSDPEGQHCRLGIDALAGDRAWDVQGKFRLRIGPLNHDQ
FRDFMPEGREFRKLQDLVRMYVGPELDFELQVSLLAAEVPAARLGTGGDDADGSRLGWNGWVLHAPSPVE
RKDAVFPMQDL
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c935218-934133 Azospirillum lipoferum 4B, complete genome
ATGGCCCGCCCGCGCCGGCAACCGCCCGCTTCTGTAATCGACCGGCTGTTCCGCGCCCCCCACCGCTTCG
ACTTCTTCCAGGCGGTGCGGGTGCTGGAATGGCAGGCCCGGCGTGACGCGCGCGACCCGCGCAACACCCG
CCGCCATGCCGTGGGCCATGACCATGACCCGCGCGAGGAGGTGGTGCGCCTGCGTGCCGAGACCTCGCTG
ACCTTCCCCGGCAACCAGGTGGCCGGGGCGGAGCCGGGGGTGGACGGCCGCCCGCCGACGCTGGTCGGCG
CCTTCCTGGGACTGGTCGGGCCGCTGGGCGTCCTGCCGCAGCACTATACCGAGTTGATGATCCGGTCTTT
GCGCGAGCGGAACCGGGCGCTGCGCGATTTCTTCGACGTCTTCCACCACCGCAGCTTCTCGCTGTTCTAC
CGCGCCTGGGCGAAATACCGGCTGCCGGTGTCCTTCGAGCGCGGCCAGGGATCGCGGGAGCCCGATCCGG
TCAGCACCACCCTGTCCAGCTTCGTCGGCATCGGCCAGCCGTCGCTGACCAAGCGTCTGGTGGTGGAGGA
CGAGACCCTTCTGCATTATTCCGGCCTGATGTCGCGCGGCACGCGCTCGGCCAACGACCTGCAGGAGATG
CTGTCGGATTTCCTCGGCCGGCCGGTGACGGTGGAGAGCTTCGTCGGCGGCTGGCTGCCCATCGCGCCGG
ACGGGCAGACGCGCCTGCCCAGCCTGTCGGACCCCGAGGGCCAGCATTGCCGGCTGGGGATCGACGCGCT
GGCCGGCGACCGCGCCTGGGATGTCCAGGGCAAGTTCCGCCTGCGCATCGGCCCGCTGAACCACGACCAG
TTCCGCGACTTCATGCCGGAAGGCCGCGAGTTCCGGAAACTGCAGGATCTGGTCCGCATGTATGTCGGGC
CGGAGTTGGATTTCGAGCTTCAGGTGAGCCTGCTGGCCGCCGAAGTACCGGCCGCCCGGCTGGGCACCGG
CGGGGACGATGCCGACGGCTCGCGGCTGGGCTGGAACGGCTGGGTGCTGCACGCGCCGAGCCCGGTCGAA
CGCAAGGACGCGGTTTTTCCGATGCAGGATTTGTGA