SecReT6
Protein ID: 374291541
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1005
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]935182..937014 [-]
Producthypothetical protein
NoteTssF
UniProt IDG7Z5W0
KEGG IDali:AZOLI_1005
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-208, Aligned region: 5..610
Protein Sequence: 610 a.a.     [Download]
>gi|374291541|ref|YP_005038576.1| hypothetical protein AZOLI_1005 [Azospirillum lipoferum 4B]
MADELLPYYNRELTYLRRMAAEFSEAHPKIAGRLRLSADAVEDPHVARLLEGVAFLNARISRKLDDEYPE
LVDTLLDVLYPHYLAPIPSMAVVQMKSSADLTGSHTVPKGTELETEALRGETCRFRTVYPATLWPIELDQ
AVLAGRPLVAPPNPRAGDAVASLRLTLRCRVPEMTFTELAPDTLRFFLRGQPQQVYALHELLFNNAVSVA
LADGPQDPNAVILGPDAIRPVGFGDEEGMLPYPARSHRGYRLLTEYFAFPEKFLFFDLHVSPKVLRRAGN
TLEIFIYLNSTDGDLERAVSKDNFALGCTPVVNLFRQRAEPVALTQTQHEHRVVPDARRPGALEVYSVDS
VLATDPDGKQRRFLPFYGLRHGGVEAVSRTYYTASRRPAGGRDPGTEVHLALVDIDFDPSSPAESVLSVE
TTCLNRDLPGQLPYGGGHPQLKLTEGMAAVAGLSCLTPPTPTLRIAERKGHRWRLVSHLLLNHLSISGGA
EGTEALREILRLYDFRDSAETRGIADGIVKVTTKRGTARAPSRPGDVAWGDAMCRGIDVGIEFDPQRFSG
SGMFLLAMILDHFLGLYCSINSFTRLTATVKGRTGVLRTWPARAGNRPLL
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c937014-935182 Azospirillum lipoferum 4B, complete genome
GTGGCTGACGAACTCCTCCCATATTACAACCGCGAGCTGACCTATCTGCGCCGCATGGCGGCGGAGTTCT
CGGAGGCGCATCCGAAGATCGCCGGCCGACTGCGGCTCAGCGCCGACGCGGTGGAGGATCCGCATGTCGC
CCGGCTGCTGGAGGGCGTCGCCTTCCTGAATGCCCGCATCAGCCGCAAGCTGGACGACGAGTATCCGGAG
CTGGTCGACACGCTGCTCGACGTGCTCTACCCGCATTATCTGGCGCCGATCCCGTCGATGGCGGTGGTGC
AGATGAAGAGCAGCGCGGACCTCACCGGCTCGCACACCGTGCCGAAGGGGACGGAGCTGGAGACGGAGGC
GCTGCGCGGGGAGACCTGCCGCTTCCGCACCGTCTATCCCGCGACCCTGTGGCCGATCGAGCTGGACCAG
GCGGTTCTCGCCGGCCGACCGCTGGTGGCGCCGCCCAACCCGCGCGCGGGCGACGCGGTGGCCTCGCTGC
GCCTGACCCTGCGCTGCCGCGTACCGGAGATGACCTTCACGGAGCTGGCGCCGGACACCCTGCGCTTCTT
CCTGCGCGGCCAACCGCAGCAGGTCTATGCCCTGCACGAGCTGCTCTTCAACAACGCCGTCTCGGTGGCG
CTGGCCGACGGCCCGCAGGATCCGAACGCGGTGATCCTCGGCCCCGACGCCATCCGCCCGGTCGGCTTCG
GCGACGAGGAGGGCATGCTTCCCTACCCCGCCCGCTCCCACCGCGGCTATCGGCTGCTGACCGAGTATTT
CGCCTTTCCGGAGAAGTTCCTGTTCTTCGACCTTCACGTCTCGCCGAAGGTGCTGCGCCGCGCCGGCAAC
ACGCTGGAGATCTTCATCTATCTGAACAGCACCGACGGCGACCTGGAGCGCGCGGTGTCGAAGGACAATT
TCGCGCTGGGCTGCACCCCGGTGGTCAACCTGTTCCGCCAGCGGGCGGAGCCGGTCGCGCTGACCCAGAC
CCAGCACGAACACCGCGTGGTTCCCGATGCCCGCCGCCCCGGCGCGCTGGAGGTCTATTCGGTCGACAGC
GTGCTGGCCACCGATCCCGACGGCAAGCAGCGGCGCTTCCTGCCCTTCTACGGCCTGCGCCACGGCGGCG
TCGAAGCGGTCAGCCGCACCTACTACACCGCCAGCCGCCGCCCGGCCGGCGGGCGCGATCCCGGCACCGA
GGTGCATCTGGCGCTGGTCGACATCGACTTCGACCCGTCGAGCCCGGCGGAGTCCGTCCTGTCGGTGGAG
ACGACCTGCCTCAACCGCGACCTGCCGGGGCAACTGCCCTATGGCGGCGGCCACCCGCAACTGAAGCTGA
CGGAGGGGATGGCGGCGGTCGCCGGCCTGTCCTGCCTGACGCCGCCGACGCCGACCCTGCGCATCGCCGA
ACGCAAGGGCCATCGCTGGCGCCTCGTCTCCCACCTGCTGCTGAACCATTTGTCGATCTCCGGCGGGGCG
GAGGGGACGGAGGCGCTGCGCGAGATCCTGCGCCTCTACGACTTCCGCGATTCGGCCGAGACCCGCGGCA
TTGCCGACGGCATCGTCAAGGTGACGACCAAGCGCGGCACCGCGCGGGCGCCGTCCCGGCCGGGCGATGT
CGCCTGGGGCGACGCCATGTGCCGCGGCATCGATGTCGGCATCGAGTTCGACCCGCAGCGCTTCAGCGGC
AGCGGCATGTTCCTGCTGGCGATGATCCTCGACCATTTCCTGGGGCTGTACTGCTCGATCAATTCCTTCA
CGCGGCTGACCGCTACGGTCAAGGGCCGCACCGGAGTGCTCCGCACATGGCCCGCCCGCGCCGGCAACCG
CCCGCTTCTGTAA