SecReT6
Protein ID: 374291542
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1006
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]937007..937483 [-]
Producthypothetical protein
NoteTssE
UniProt IDG7Z5W1
KEGG IDali:AZOLI_1006
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.90E-22, Aligned region: 30..137
Protein Sequence: 158 a.a.     [Download]
>gi|374291542|ref|YP_005038577.1| hypothetical protein AZOLI_1006 [Azospirillum lipoferum 4B]
MDRNQSITLSVLDRLLDDTPEHVAPRPHTVADLRAAIRRDLENLLNTRRRVLGWPDDLTELADSILGYGC
HDLLVENVATESRRREVVAQIEAAIRRWEPRFAQLAVTMVDNSDPADRTLRFRIEALIHADPAPEPMVFD
SVVDPTSNMVTVTSKARG
 
Nucleotide Sequence: 477 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c937483-937007 Azospirillum lipoferum 4B, complete genome
ATGGATCGCAACCAGTCCATCACCCTGTCCGTCCTGGACCGTCTGCTCGACGATACGCCGGAGCATGTGG
CGCCGCGGCCGCACACCGTGGCGGACCTGCGGGCGGCGATCCGGCGCGACCTGGAGAACCTGCTGAACAC
CCGGCGGCGGGTGCTGGGCTGGCCGGACGACCTGACGGAGCTGGCGGATTCGATCCTCGGCTATGGCTGC
CACGACCTGCTGGTGGAGAATGTCGCCACCGAATCCCGCCGGCGCGAGGTGGTGGCGCAGATCGAGGCGG
CGATCCGGCGGTGGGAGCCGCGCTTCGCCCAGCTGGCGGTGACCATGGTCGACAACAGCGACCCGGCCGA
CCGCACCCTGCGCTTCCGGATCGAGGCGCTGATCCATGCCGACCCGGCGCCCGAACCGATGGTCTTCGAT
TCGGTGGTCGATCCCACCTCCAACATGGTCACCGTGACGAGCAAGGCCCGTGGCTGA