SecReT6
Protein ID: 374291543
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1007
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]937662..938459 [-]
Productputative avirulence protein (ImpE-like) involved in protein secretion
NoteTagJ
UniProt IDG7Z4J2
KEGG IDali:AZOLI_1007
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.50E-33, Aligned region: 139..261
TPR_19 [PF14559], Evalue: 2.10E-05, Aligned region: 8..64
TPR_19 [PF14559], Evalue: 2.10E-05, Aligned region: 112..128
TPR_19 [PF14559], Evalue: 2.10E-05, Aligned region: 214..226
TPR_14 [PF13428], Evalue: 0.0018, Aligned region: 5..41
TPR_14 [PF13428], Evalue: 0.0018, Aligned region: 38..64
TPR_14 [PF13428], Evalue: 0.0018, Aligned region: 108..132
TPR_14 [PF13428], Evalue: 0.0018, Aligned region: 213..230
TPR_2 [PF07719], Evalue: 0.0083, Aligned region: 6..22
TPR_2 [PF07719], Evalue: 0.0083, Aligned region: 39..51
TPR_2 [PF07719], Evalue: 0.0083, Aligned region: 104..132
Protein Sequence: 265 a.a.     [Download]
>gi|374291543|ref|YP_005038578.1| putative avirulence protein (ImpE-like) involved in protein secretion [Azospirillum lipoferum 4B]
MSETAAQLFQAGRLDEAITALNGEIKKKPTDLDRRVFLAELLSFAGNLERADLQLDTIGTQEPQVAVTMA
LFRQLVRAEQARRQLFADGRVPEFIDQPADHLRLHLEALVALRAGDTADAVAKLAQAEEMRPPVSGSHDG
TPFDDFRDLDDLTGGFFEVYTSTGKYFWIASETVELVEFRAPQRPRDLLWRPAHMVVRGGPDGEVYLPTL
YGGAPADAEDALKLGRATDWSEDTPVRGIGQRCFLVGEESIPMLQLGTLEFSGAV
 
Nucleotide Sequence: 798 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c938459-937662 Azospirillum lipoferum 4B, complete genome
ATGAGCGAAACCGCAGCCCAGCTGTTCCAGGCGGGCCGCCTCGACGAGGCGATCACCGCGCTGAACGGCG
AGATCAAGAAGAAGCCGACCGATCTCGACCGCCGCGTCTTCCTGGCCGAGCTGCTGAGCTTCGCCGGCAA
CCTGGAGCGCGCCGACCTGCAGCTCGACACCATCGGCACGCAGGAGCCGCAGGTCGCCGTCACCATGGCG
CTGTTCCGCCAGCTGGTGCGGGCCGAGCAGGCGCGGCGCCAGCTGTTCGCCGACGGCCGCGTGCCGGAAT
TCATCGACCAGCCGGCCGACCATCTGCGCCTGCATCTGGAGGCGCTGGTCGCCCTGCGCGCCGGCGACAC
CGCCGACGCCGTGGCGAAGCTGGCCCAGGCCGAGGAGATGCGCCCGCCGGTGTCCGGCAGCCATGACGGC
ACGCCTTTCGACGATTTCCGCGACCTGGACGACCTGACCGGCGGCTTCTTCGAGGTCTACACCAGCACCG
GCAAGTATTTCTGGATCGCCAGCGAGACGGTGGAGCTGGTCGAGTTCCGCGCGCCCCAGCGCCCTCGCGA
CCTGCTGTGGCGCCCGGCGCACATGGTGGTGCGTGGCGGCCCGGACGGCGAGGTCTATCTGCCCACGCTG
TACGGCGGCGCCCCGGCCGATGCCGAGGATGCGCTGAAGCTGGGCCGGGCGACGGACTGGTCGGAGGATA
CACCGGTGCGGGGCATCGGCCAGCGCTGCTTCCTGGTCGGCGAGGAGAGCATTCCGATGCTGCAGCTTGG
CACGCTGGAGTTCTCGGGGGCGGTGTGA