SecReT6
Protein ID: 374291544
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1008
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]938510..940060 [-]
Producthypothetical protein
NoteTssC
UniProt IDG7Z4J3
KEGG IDali:AZOLI_1008
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-156, Aligned region: 74..509
Protein Sequence: 516 a.a.     [Download]
>gi|374291544|ref|YP_005038579.1| hypothetical protein AZOLI_1008 [Azospirillum lipoferum 4B]
MTGQAAEFHADDAEATVLERPLRLRAVDMALGRDDAGPLDAFLAANGPGEALRLWFGITLPVHDSLDKLR
AALDRDIAAIDALLSEQVNAILHHKRFQSLEGSWRGVRTLVKQAQNAETVVLRLLNLTWPELCRDQERAI
EFDQSQLFNKVYSDEFGMPGGRPFGVLLCDYAVQHRPTRERPTDDVSGLKGLAQVAAAAFAPAIVGAAPE
LFGLETFHELGLPLDLKSVLRQAEYQRWQRFQETEDSRFVGVALPRVLMREPYGDDPQARHGFRFREESV
GGEGGMRLEDHCWGNAVYAFGTVLIRSFLQHGWFADIRGAQRNVVGGGLVTELVVPDFATDSVKVAQKFS
IEVSISDQLERDLDDLGFIPVSRCKDTPYLVFYGNQSVQRVGQLTTATATANARLSAMLRYMFCVARFAH
FLKVMVRDRVGSFVTPEECERDLQSWLHGYCLGNDDASLDQKARYPLREGSIQVRAIPGKPGNYQCVIHL
RPHFQLDQVFSTFKLVTELAQTGGAA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c940060-938510 Azospirillum lipoferum 4B, complete genome
ATGACCGGCCAGGCTGCCGAATTCCACGCCGACGACGCGGAGGCGACGGTCCTTGAACGGCCGTTGCGTC
TGCGGGCGGTCGACATGGCGCTCGGCCGCGACGATGCCGGCCCGCTCGACGCCTTCCTGGCGGCCAATGG
CCCCGGGGAGGCGCTGCGGCTGTGGTTCGGCATCACGCTGCCCGTTCATGACAGCCTGGACAAGCTGCGC
GCCGCGCTCGACCGCGACATCGCGGCCATCGACGCGCTGCTGTCCGAACAGGTCAACGCCATCCTGCACC
ACAAGCGCTTCCAGTCGCTGGAAGGCTCGTGGCGCGGGGTGCGCACGCTGGTGAAGCAGGCGCAGAACGC
CGAGACGGTGGTGCTGCGCCTGCTCAACCTGACCTGGCCCGAACTGTGCCGCGACCAGGAACGCGCTATC
GAGTTCGACCAGAGCCAGCTGTTCAACAAGGTCTACAGCGACGAATTCGGCATGCCCGGCGGTCGCCCCT
TCGGCGTGCTGCTGTGCGATTATGCCGTCCAGCACCGCCCGACCAGGGAGCGGCCGACCGACGACGTCTC
CGGCCTCAAGGGGCTGGCGCAGGTCGCCGCCGCCGCCTTCGCGCCGGCCATCGTCGGCGCGGCGCCCGAG
CTGTTCGGGCTGGAGACCTTCCACGAGCTCGGCCTGCCGCTGGATCTCAAATCGGTGCTGCGGCAAGCGG
AGTACCAGCGCTGGCAACGCTTCCAGGAGACCGAGGATTCGCGGTTCGTCGGCGTGGCCCTGCCGCGCGT
GCTGATGCGCGAACCCTATGGCGACGATCCGCAGGCCCGTCACGGCTTCCGCTTCCGCGAGGAATCGGTG
GGCGGAGAGGGAGGCATGCGGCTGGAGGACCATTGCTGGGGCAATGCCGTCTATGCCTTCGGCACCGTGC
TGATCCGCTCCTTCCTGCAGCATGGCTGGTTCGCCGACATCCGCGGCGCCCAGCGCAACGTGGTGGGCGG
CGGGCTGGTGACCGAGCTGGTGGTGCCGGATTTCGCCACCGACAGCGTGAAGGTCGCGCAGAAATTCTCG
ATAGAGGTCTCGATCTCCGACCAGTTGGAGCGCGATCTCGACGATCTCGGCTTCATTCCGGTCAGCCGCT
GCAAGGACACGCCCTATCTGGTCTTCTACGGCAACCAGTCGGTCCAGCGGGTCGGCCAGCTCACCACCGC
CACGGCGACGGCCAACGCCCGGCTGTCGGCGATGCTGCGATACATGTTCTGCGTGGCACGCTTCGCCCAT
TTCCTGAAGGTGATGGTACGCGACCGCGTCGGCTCCTTCGTCACGCCGGAGGAATGCGAGCGCGACCTGC
AGAGCTGGCTGCACGGCTATTGCCTGGGCAACGACGACGCCAGCCTGGACCAGAAGGCCCGCTATCCCTT
GCGCGAGGGCAGCATCCAGGTCCGCGCCATTCCGGGCAAGCCCGGCAATTATCAATGCGTCATCCATCTT
CGGCCGCACTTCCAGCTGGATCAGGTCTTCTCGACCTTCAAGCTGGTGACCGAGCTGGCCCAAACCGGCG
GAGCGGCCTGA