SecReT6
Protein ID: 374291545
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1009
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]940068..941561 [-]
Producthypothetical protein
NoteTssC
UniProt IDG7Z5W2
KEGG IDali:AZOLI_1009
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-196, Aligned region: 65..494
Protein Sequence: 497 a.a.     [Download]
>gi|374291545|ref|YP_005038580.1| hypothetical protein AZOLI_1009 [Azospirillum lipoferum 4B]
MSDAQTQGAGATGAVAEGTGLSILDQAIAATKQTEPDRAQELLRTLTQEALAGTVTFNKNLGQTINKAIA
AIDAKISKQLNAIMHHEKFQKLEGSWRGLNYLVMNSETGSTLKIRVMNCPKKDLYKDISKAVEFDQSNLF
KKIYENEFGIAGGEPYGALIGDYEFTNHPDDMELLTGVSNVAAAAFAPFISAASPKLFGFEDMTELSKPR
DLEKIFDSVEYAKWRSFRESDDSRFVTLTMPRVLARMPYGANTKPIEEFEYEEAPYEGGIARPMAHNDYC
WMNASYAMGQRLTNAFSQYGWCTAIRGAEGGGKVENLPFHTFTSDDGDSDAKCPTEIGITDRREAELSKL
GFLPLCHYKNQDYAVFFGAQTTQKPKKYDRPEATANAAISARLPYIMATSRFAHYLKIMARDKIGSFMEA
SDCEAWLNRWILNYVNGNEAAGQEMKAKYPLAEAKVQVKEIPGKPGSYNAVAWMRPWLQMEELTTSMRMV
ARIPQAG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c941561-940068 Azospirillum lipoferum 4B, complete genome
ATGAGCGACGCTCAGACCCAGGGCGCAGGCGCCACCGGCGCCGTTGCCGAAGGTACCGGCCTCTCGATTC
TCGACCAGGCCATCGCCGCCACCAAGCAGACCGAGCCGGACCGTGCGCAGGAGCTGCTGCGCACCCTGAC
CCAGGAAGCGCTGGCCGGCACGGTCACCTTCAACAAGAACCTGGGCCAGACGATCAACAAGGCGATCGCC
GCGATCGACGCCAAGATCAGCAAGCAGCTCAACGCCATCATGCACCACGAGAAGTTCCAGAAGCTGGAAG
GCTCGTGGCGCGGCCTGAACTATCTGGTCATGAATTCGGAAACGGGCTCCACGCTCAAGATCCGCGTCAT
GAACTGCCCGAAGAAGGACCTGTACAAGGACATCTCGAAGGCGGTCGAGTTCGACCAGAGCAACCTGTTC
AAGAAGATCTACGAGAACGAGTTCGGCATCGCCGGCGGCGAACCCTACGGCGCCCTGATCGGCGACTACG
AGTTCACCAACCACCCCGACGACATGGAGCTGCTGACTGGCGTCTCCAACGTCGCGGCGGCCGCCTTCGC
TCCCTTCATCTCGGCCGCCAGCCCGAAGCTGTTCGGCTTCGAGGACATGACCGAGCTGTCGAAGCCGCGC
GACCTGGAGAAGATCTTCGACAGCGTCGAATACGCCAAGTGGCGCAGCTTCCGTGAGAGCGACGACAGCC
GCTTCGTCACGTTGACCATGCCGCGCGTGCTCGCCCGCATGCCTTACGGCGCCAACACCAAGCCGATCGA
GGAGTTCGAGTACGAGGAAGCCCCGTACGAAGGCGGTATCGCCCGGCCGATGGCCCACAACGACTACTGC
TGGATGAACGCCTCCTACGCGATGGGCCAGCGCCTGACCAACGCCTTCTCGCAGTATGGCTGGTGCACGG
CCATCCGCGGCGCCGAGGGCGGCGGCAAGGTGGAGAACCTGCCCTTCCACACCTTCACCTCGGACGACGG
CGACAGCGACGCCAAGTGCCCGACCGAGATCGGCATCACCGACCGCCGCGAGGCCGAGCTGTCGAAGCTG
GGCTTCCTGCCGCTCTGCCACTACAAGAACCAGGACTACGCCGTCTTCTTCGGCGCCCAGACCACGCAGA
AGCCCAAGAAGTACGACCGGCCGGAGGCGACCGCGAACGCCGCGATCTCCGCCCGCCTGCCCTACATCAT
GGCGACCTCGCGTTTCGCCCACTACTTGAAGATCATGGCGCGCGACAAGATCGGCTCCTTCATGGAGGCG
AGCGACTGCGAGGCGTGGCTGAACCGCTGGATCCTGAACTACGTCAACGGCAACGAAGCCGCGGGCCAGG
AGATGAAGGCGAAGTACCCGCTGGCCGAAGCCAAGGTGCAGGTGAAGGAGATCCCGGGCAAGCCCGGCTC
CTACAACGCCGTCGCCTGGATGCGCCCGTGGCTGCAGATGGAGGAACTGACCACCTCCATGCGCATGGTC
GCCCGCATCCCGCAGGCCGGCTGA