SecReT6
Protein ID: 374291546
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1010
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]941566..942072 [-]
Producthypothetical protein
NoteTssB
UniProt IDG7Z5W3
KEGG IDali:AZOLI_1010
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-62, Aligned region: 8..162
Protein Sequence: 168 a.a.     [Download]
>gi|374291546|ref|YP_005038581.1| hypothetical protein AZOLI_1010 [Azospirillum lipoferum 4B]
MASIHQKLDRVRKPRVHITYDVETEGATVVKELPFVVGVLGDFSGDPTEPLKPLKDRKFIQIDRDNFNDV
MARMTPGLKMKVENTLADDGTEMAVELAFKSMEDFEPGRVVQQVEPLRKLLETRNQLRDLLSKADRSEEL
EGLLERVLQNTDELKALSGELGTEKKEG
 
Nucleotide Sequence: 507 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c942072-941566 Azospirillum lipoferum 4B, complete genome
ATGGCGAGTATCCACCAGAAGCTGGATCGCGTGCGCAAGCCCCGCGTCCACATCACCTACGACGTCGAGA
CCGAGGGTGCGACCGTCGTCAAGGAGCTGCCCTTCGTCGTCGGCGTGCTCGGCGACTTCTCGGGCGACCC
GACGGAGCCGCTGAAGCCCCTGAAGGACCGCAAGTTCATCCAGATCGACCGCGACAACTTCAACGACGTC
ATGGCCCGCATGACGCCCGGCCTGAAGATGAAGGTGGAAAACACCCTGGCCGACGACGGCACCGAGATGG
CTGTCGAGCTCGCCTTCAAGTCGATGGAGGATTTCGAGCCGGGCCGCGTCGTCCAGCAGGTCGAGCCGCT
GCGCAAGCTGCTGGAGACCCGCAACCAGCTGCGCGACCTGCTGAGCAAGGCCGACCGCTCGGAAGAGCTG
GAGGGCCTGCTGGAGCGCGTGCTGCAGAACACCGACGAGCTGAAGGCGCTGAGCGGCGAGCTCGGCACCG
AGAAGAAGGAGGGTTGA