SecReT6
Protein ID: 374291547
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1011
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]942117..943259 [-]
Producthypothetical protein
NoteTssA
UniProt IDG7Z5W4
KEGG IDali:AZOLI_1011
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-21, Aligned region: 64..124
Protein Sequence: 380 a.a.     [Download]
>gi|374291547|ref|YP_005038582.1| hypothetical protein AZOLI_1011 [Azospirillum lipoferum 4B]
MPTPQIFDIEELLQPIEGDSECGIDLRENASADYYTVKDARSAARAAERSMDVEDDAGGLLPEWRTILEV
SPRILRTQAKDLEVTAWFIEALLRAEGYAGLRDGFALARGLVERFWDNLYPAPDEDGIATRVGPLTGLNG
ESADGTLIQPVRKVPLTMGDIPYSLWQYEQAIELAKITDEARRQARIDNGAVTWEQFEQSVRETPASEFK
TLLEDIQGAIDEFEALGKILYDKAGYDAPPAGNIRNVLTAALDAVNYAARDRLATLGGDEPAAAEAASAS
TDPAATTGGGAVAAAGAKVQASGAVTTREEAFKVLLQVADFFRKTEPHSPISYTLEEVVRRGRMSLQELL
QELITDEETRRQFFIASGAKAPPPAEQSGY
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c943259-942117 Azospirillum lipoferum 4B, complete genome
ATGCCCACACCGCAGATTTTCGACATCGAAGAGCTTTTGCAGCCGATCGAAGGAGACTCCGAATGCGGAA
TCGACCTTCGCGAGAATGCCTCGGCCGACTACTACACCGTTAAGGATGCCCGCAGCGCCGCCCGCGCCGC
CGAACGATCCATGGATGTGGAGGACGACGCCGGCGGCCTTCTGCCGGAATGGCGCACCATTCTGGAAGTC
AGCCCGCGGATCCTGCGCACCCAGGCCAAGGACCTCGAAGTCACCGCCTGGTTCATCGAGGCGCTGCTGC
GGGCGGAGGGCTATGCCGGCCTGCGCGACGGCTTCGCGCTGGCCCGCGGGCTGGTGGAGCGGTTCTGGGA
CAACCTCTACCCGGCCCCGGACGAGGACGGCATCGCCACCCGCGTCGGCCCGCTGACCGGCCTGAACGGC
GAATCGGCCGACGGCACGCTGATCCAGCCGGTCCGCAAGGTGCCGCTGACCATGGGCGACATTCCCTATT
CGCTCTGGCAGTACGAGCAGGCCATCGAACTGGCGAAGATCACCGACGAGGCGCGCCGTCAGGCGCGCAT
CGACAACGGCGCCGTGACCTGGGAACAGTTCGAGCAGAGCGTCCGCGAGACGCCGGCCTCCGAATTCAAG
ACGCTGCTGGAGGATATCCAGGGCGCCATCGACGAGTTCGAGGCGCTGGGCAAAATCCTCTACGACAAGG
CCGGCTACGATGCGCCGCCGGCCGGCAATATCCGCAACGTCCTGACGGCGGCTCTCGACGCGGTGAACTA
CGCCGCGCGCGACCGGCTGGCGACGCTGGGCGGCGACGAGCCCGCCGCGGCGGAGGCCGCCTCCGCGTCC
ACCGATCCGGCCGCGACGACCGGCGGCGGGGCGGTCGCGGCTGCCGGCGCCAAGGTGCAGGCAAGCGGGG
CTGTGACAACGCGCGAAGAAGCCTTCAAGGTCCTCTTGCAGGTCGCCGATTTCTTCCGCAAGACGGAACC
CCATTCCCCCATCTCCTATACGCTGGAGGAGGTGGTCCGCCGCGGCCGCATGTCTTTGCAGGAACTCCTG
CAGGAGCTCATCACGGACGAGGAGACGCGGCGGCAGTTCTTCATCGCGTCCGGCGCCAAGGCGCCGCCGC
CGGCAGAGCAATCAGGGTATTGA