SecReT6
Protein ID: 374291551
SecReT6 ID525
T6SS typei5
Gene symbolclpB3
Locus tagAZOLI_1015
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]945499..948189 [+]
ProductATP-dependent chaperone; type VI secretion associated protein
NoteTssH
UniProt IDG7Z4J7
KEGG IDali:AZOLI_1015
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-40, Aligned region: 627..794
AAA_2 [PF07724], Evalue: 2.20E-40, Aligned region: 848..868
AAA [PF00004], Evalue: 5.20E-16, Aligned region: 233..365
AAA [PF00004], Evalue: 5.20E-16, Aligned region: 633..756
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 233..252
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 292..363
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 632..751
ClpB_D2-small [PF10431], Evalue: 3.10E-13, Aligned region: 800..872
AAA_16 [PF13191], Evalue: 5.50E-11, Aligned region: 83..94
AAA_16 [PF13191], Evalue: 5.50E-11, Aligned region: 210..253
AAA_16 [PF13191], Evalue: 5.50E-11, Aligned region: 278..311
AAA_16 [PF13191], Evalue: 5.50E-11, Aligned region: 497..550
AAA_16 [PF13191], Evalue: 5.50E-11, Aligned region: 602..653
AAA_16 [PF13191], Evalue: 5.50E-11, Aligned region: 697..719
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 217..247
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 632..750
AAA_22 [PF13401], Evalue: 1.90E-05, Aligned region: 232..314
AAA_22 [PF13401], Evalue: 1.90E-05, Aligned region: 358..398
AAA_22 [PF13401], Evalue: 1.90E-05, Aligned region: 630..653
AAA_22 [PF13401], Evalue: 1.90E-05, Aligned region: 694..712
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 131..155
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 228..253
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 617..672
NACHT [PF05729], Evalue: 0.00025, Aligned region: 233..261
NACHT [PF05729], Evalue: 0.00025, Aligned region: 632..659
AAA_25 [PF13481], Evalue: 0.0024, Aligned region: 233..271
AAA_25 [PF13481], Evalue: 0.0024, Aligned region: 630..653
AAA_25 [PF13481], Evalue: 0.0024, Aligned region: 694..716
Arch_ATPase [PF01637], Evalue: 0.0097, Aligned region: 212..249
Arch_ATPase [PF01637], Evalue: 0.0097, Aligned region: 286..317
Arch_ATPase [PF01637], Evalue: 0.0097, Aligned region: 633..645
IstB_IS21 [PF01695], Evalue: 0.0098, Aligned region: 217..251
IstB_IS21 [PF01695], Evalue: 0.0098, Aligned region: 632..650
IstB_IS21 [PF01695], Evalue: 0.0098, Aligned region: 743..766
Protein Sequence: 896 a.a.     [Download]
>gi|374291551|ref|YP_005038586.1| ATP-dependent chaperone; type VI secretion associated protein [Azospirillum lipoferum 4B]
MVAVDLQSMISRLNPLCRRALEAAAGQTLSRTHYNCEIEHWLLQLIGAADGDISAILRVYEIDAGRLSAD
LTRVLDKLKTGNSRAPALSPNLVQLMREAWVLASLQYGEGAVRSGHLLAALLSDESLSAQARDMSGQFAK
ITADVLRRDLPKIVADTAEARTSAPVAAAGGAAGGVAAGGAPKAGGATPNLDQYTIDLTDRAKNGKIDPV
LGRDAEIRQIIDVLTRRRQNNPILTGEAGVGKTAVVEGFALRIAAGDVPPDLRNVRLLSLDLGLLQAGAG
MKGEFENRLKGVIDEVKGSSQPIVMFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRTVAATTWAEYK
KYFEKDPALTRRFQVVKVEEPAEPVAVDMMRGLTATLEKHHKVRIVTEGLIESVRLSSRYIPARQLPDKA
VSLLDTACARVAMSQTATPPAIEDRRRTIQLTETEVAILEREEAIGIDHAELLAALKDKIAATQADLEAL
EARWTKELELVKAINETRDQLVAAHEQSKAPAAEGAPAAEPLDADALNAKLSALTAELTALQGEDPLVKV
AVDGQAVAEVVANWTGVPVGRMVSNEIKTILSLADRMKERIIGQDHALDAIAQAMWTSRAKLTDPRKPIG
VFLMVGTSGVGKTETALTLADLIYGGEQNVTTINMTEYKEEHKVSLLLGSPPGYVGFGEGGVLTEAVRRR
PYSVVLLDELEKAHPGVQDIFFQVFDKGTIKDGEGRDIDFKNTVIIMTSNAGTDLIHKLCADPETAPDAD
GLLEALHPELQKSFKPAFLGRCTVIPYFQLSDENLAKIVVLQLNRIAKRVVQNYKAAFSYSDDLVQSIVN
RCQEVSSGARNIETILSRTLLPEISSRILARMGDGEPITRIHVSVDGEDRFVYDIA
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|374290655|ref|NC_016622.1|:945499-948189 Azospirillum lipoferum 4B, complete genome
ATGGTGGCGGTCGATCTGCAGAGCATGATTTCGCGGCTGAATCCTCTGTGCCGGCGGGCGTTGGAGGCTG
CGGCCGGACAGACCCTGTCGCGCACGCATTACAATTGCGAGATCGAGCACTGGCTTCTCCAGCTGATCGG
CGCCGCCGACGGCGACATCTCCGCCATTCTGCGCGTCTACGAGATCGATGCCGGCCGCCTGTCCGCCGAC
CTGACGCGGGTGCTGGACAAGCTGAAGACCGGCAACAGCCGGGCGCCGGCCCTGTCGCCCAATCTGGTGC
AGCTGATGCGCGAGGCGTGGGTGCTGGCCTCGCTGCAATATGGCGAGGGGGCGGTGCGCTCCGGCCATCT
GCTGGCGGCTCTGCTGTCCGACGAATCGCTGTCGGCCCAGGCGCGCGACATGTCCGGCCAGTTCGCGAAG
ATCACCGCGGACGTGCTGCGGCGTGACCTTCCCAAGATCGTCGCCGATACGGCGGAGGCGCGCACCAGCG
CACCGGTCGCCGCGGCGGGCGGAGCAGCCGGCGGGGTCGCCGCGGGCGGCGCGCCGAAGGCCGGCGGGGC
GACCCCCAACCTCGACCAGTACACCATCGACCTGACCGACCGCGCCAAGAACGGCAAGATCGATCCGGTG
CTGGGCCGCGACGCCGAGATCCGCCAGATCATCGACGTGCTGACCCGCCGCCGCCAGAACAACCCGATCC
TGACCGGCGAAGCCGGTGTCGGCAAGACGGCGGTGGTCGAAGGCTTCGCGCTGCGCATCGCCGCCGGCGA
CGTGCCGCCGGACCTGCGCAACGTCCGCCTGCTGTCGCTCGACCTCGGCCTGCTGCAGGCCGGCGCCGGC
ATGAAGGGCGAGTTCGAGAACCGGCTGAAGGGCGTGATCGACGAGGTGAAGGGCTCCAGCCAGCCCATCG
TCATGTTCATCGACGAGGCGCACACCCTGATCGGCGCTGGCGGGCAGGCCGGCCAGAACGACGCCGCCAA
CCTGCTGAAGCCGGCGCTGGCGCGCGGCGAGATGCGCACCGTCGCCGCCACCACCTGGGCCGAATACAAG
AAGTATTTCGAGAAGGACCCGGCGCTGACCCGCCGCTTCCAGGTGGTGAAGGTGGAGGAGCCGGCGGAGC
CGGTCGCCGTCGACATGATGCGCGGCCTGACCGCCACGCTGGAGAAGCACCACAAGGTCCGCATCGTGAC
GGAGGGGTTGATCGAATCGGTCCGCCTGTCCAGCCGCTACATCCCGGCGCGCCAGCTTCCCGACAAGGCG
GTCAGCCTGCTGGACACCGCCTGCGCCCGCGTGGCGATGAGCCAGACCGCGACGCCGCCGGCCATCGAGG
ATCGCCGCCGCACCATCCAGCTGACCGAGACCGAGGTCGCGATCCTGGAGCGCGAGGAGGCCATCGGCAT
CGACCATGCCGAACTGCTCGCCGCGCTGAAGGACAAGATCGCCGCCACCCAGGCCGACCTTGAGGCGCTG
GAGGCGCGCTGGACCAAGGAACTGGAGCTGGTCAAGGCGATCAACGAGACGCGCGACCAGCTGGTCGCCG
CGCATGAGCAGTCCAAGGCCCCGGCTGCGGAGGGGGCTCCTGCCGCCGAGCCGCTCGACGCGGATGCGCT
GAACGCCAAGCTGTCGGCGCTGACCGCCGAGCTGACCGCTCTGCAGGGCGAGGATCCGCTGGTCAAGGTC
GCGGTGGACGGGCAGGCGGTGGCCGAAGTGGTCGCCAACTGGACCGGCGTTCCGGTCGGCCGCATGGTCT
CCAACGAGATCAAGACCATCCTGTCGCTCGCCGACCGCATGAAGGAGCGGATCATCGGCCAGGACCACGC
GCTGGACGCCATCGCCCAGGCGATGTGGACCAGCCGGGCCAAGCTGACCGACCCGCGCAAGCCGATCGGC
GTCTTCCTGATGGTCGGCACGTCGGGCGTCGGCAAGACCGAGACGGCGCTGACGCTCGCCGACCTGATCT
ATGGCGGTGAGCAGAACGTCACCACCATCAACATGACCGAGTACAAGGAGGAGCATAAGGTCTCCCTGCT
GCTCGGATCTCCTCCCGGCTATGTCGGCTTCGGCGAGGGCGGCGTCCTGACCGAGGCGGTGCGCCGCCGG
CCCTACAGCGTCGTCCTGCTGGACGAGCTGGAGAAGGCCCATCCCGGCGTGCAGGACATCTTCTTCCAGG
TGTTCGACAAGGGCACGATCAAGGACGGCGAAGGCCGTGACATCGACTTCAAGAACACCGTCATCATCAT
GACGTCGAATGCCGGCACGGACCTGATCCACAAGCTGTGCGCCGACCCGGAGACGGCGCCCGACGCCGAT
GGCCTGCTGGAGGCCCTGCATCCCGAACTGCAGAAGAGCTTCAAGCCGGCCTTCCTCGGCCGCTGCACGG
TCATCCCCTACTTCCAGTTGTCGGACGAGAATCTGGCGAAGATCGTTGTCCTGCAGTTGAACCGCATCGC
CAAGCGGGTGGTGCAGAACTACAAGGCCGCCTTCTCCTACTCCGACGATCTGGTCCAGAGCATCGTCAAC
CGGTGCCAGGAGGTGTCGAGCGGCGCCCGCAACATCGAGACGATCCTGAGCCGCACGCTTCTGCCGGAGA
TCTCGTCCCGCATCCTCGCCCGCATGGGCGACGGCGAGCCGATCACCCGCATCCACGTCTCGGTCGATGG
CGAAGACCGCTTCGTCTACGACATCGCCTGA