SecReT6
Protein ID: 374291552
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1016
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]948342..948818 [+]
Producthypothetical protein
NoteTssD
UniProt IDG7Z4J8
KEGG IDali:AZOLI_1016
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.40E-32, Aligned region: 4..133
Protein Sequence: 158 a.a.     [Download]
>gi|374291552|ref|YP_005038587.1| hypothetical protein AZOLI_1016 [Azospirillum lipoferum 4B]
MAIYVKYDGIDGEATHETHKKWLDVSSLQWGVGRAISTPSGSTANREASEPSVSEVTITKQMDSSSPKFF
VESCTGAIGKKVQIHLVTTGSPGNTYAEYTLTNALVSAYSMSSGGDRPSESISISFTKMEYKFIPYDDKN
KAGTPISVSYDLSTTKSA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|374290655|ref|NC_016622.1|:948342-948818 Azospirillum lipoferum 4B, complete genome
ATGGCGATCTATGTTAAGTACGACGGCATCGACGGCGAGGCCACGCACGAGACCCACAAGAAGTGGCTGG
ACGTCAGTTCGCTGCAGTGGGGCGTCGGCCGTGCCATCAGCACCCCGTCGGGTTCGACCGCCAACCGCGA
AGCGTCGGAGCCGTCGGTGTCGGAAGTGACCATCACCAAGCAGATGGACAGCTCCTCGCCGAAGTTCTTC
GTCGAATCCTGCACCGGCGCCATCGGCAAGAAGGTGCAGATCCATCTCGTCACCACCGGCAGCCCGGGCA
ACACCTATGCCGAGTACACCCTGACCAACGCCCTGGTCTCGGCCTACTCGATGTCGTCGGGCGGTGACCG
TCCGTCGGAATCGATCTCCATCAGCTTCACCAAGATGGAGTACAAGTTCATTCCGTACGACGACAAGAAC
AAGGCCGGCACGCCGATCTCGGTCTCCTACGACCTGTCGACGACCAAGAGCGCCTAA