SecReT6
Protein ID: 374291553
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1018
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]948964..951084 [+]
Producthypothetical protein
NoteTssI
UniProt IDG7Z5W5
KEGG IDali:AZOLI_1018
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-66, Aligned region: 33..334
Phage_base_V [PF04717], Evalue: 1.00E-23, Aligned region: 373..465
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 517..539
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 533..557
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 541..565
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 559..584
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 586..611
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 604..619
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 674..689
Gp5_C [PF06715], Evalue: 2.70E-10, Aligned region: 689..700
DUF2345 [PF10106], Evalue: 0.00016, Aligned region: 500..569
DUF2345 [PF10106], Evalue: 0.00016, Aligned region: 582..670
Protein Sequence: 706 a.a.     [Download]
>gi|374291553|ref|YP_005038588.1| hypothetical protein AZOLI_1018 [Azospirillum lipoferum 4B]
MSDAPTISQTGRLLSLTSPLGADVLIPVAVEGEEGLSRLFRYTITMISPRMTVAPADILGKSLTLSVARQ
GGSPRIINGIVKSFSAGPLALRGYRRYTAEIVPSLWLATLRSDCQVFQDKSVVQIVDTMLSDCGVTEVKK
QGLSGTHNARPVCVQYRETHFDFIARLLQDEGIYFYFQHEAGKHTLVLSDSASGYTDCLDKNVIHAAASQ
GNTLVIDGWSHSQSYVSGKWTLQDYNFETPSTDLAASTTTVLGVSAFKSHEMFDYPGGHMVKADGTTLSR
LRMEETETGYERVEGTATYRGLSAGGKISMAGHAVTAEVGKGYVITDLALSAQDETHLGNGGMPPQFSCR
FAAIPEATVFRPPPVPRPRTHGPDTATVVGPSGEEIYCDKYGRVRVQFHWDRKGTDDEKSFVWLRVAQTM
AGKNWGTIFTPRVGMEVLVDYIGGDPDRPLIVGCVYNAENMPPYTLPDNKTQSGIKTRSSKGGDTATFNE
LRFEDKKDAEEIYFHAQKDFKRVVENDDTLQVDHDQTITIKNDRTETVSEGNETVTIAKGNRSVTVSEGN
DTHDVTKGNRTLTVGEGNRTVTVSKGNDTHTVSQGNRTVDVGQGNDSLTVGQGNMAIDVKQGDYALKLGL
GDVSVKASTGKITMEATTSIELKVGGNSVKIDQTGITVKGLMVKVTGDSQVQIKGAMTQVNGDAMVQVKG
GVVTIN
 
Nucleotide Sequence: 2121 bp     [Download]
>gi|374290655|ref|NC_016622.1|:948964-951084 Azospirillum lipoferum 4B, complete genome
ATGTCGGATGCGCCCACCATCTCGCAGACCGGCCGGCTTCTGTCGCTGACCTCGCCGCTCGGCGCGGACG
TGCTGATCCCGGTTGCCGTCGAGGGAGAGGAAGGGCTGTCGCGCCTGTTCCGCTACACCATCACCATGAT
CTCGCCGCGGATGACCGTCGCGCCGGCCGACATCCTTGGAAAGTCGCTGACGCTGTCCGTCGCGCGCCAG
GGTGGCAGCCCCCGCATTATCAACGGCATCGTGAAGAGTTTTTCCGCCGGGCCGCTGGCTCTGCGCGGCT
ACCGCCGCTATACGGCGGAGATCGTGCCGTCCCTGTGGCTGGCGACCCTGCGCTCCGACTGCCAGGTGTT
CCAGGACAAGAGCGTCGTGCAGATCGTCGACACCATGCTGTCCGACTGCGGCGTGACCGAGGTGAAGAAG
CAGGGGCTGTCCGGCACCCACAACGCCCGCCCTGTCTGTGTGCAGTACCGCGAAACCCATTTCGACTTCA
TCGCCCGCCTGCTGCAGGACGAGGGCATCTATTTCTATTTCCAGCACGAGGCCGGCAAGCACACGCTGGT
GCTGAGCGACAGCGCGTCGGGCTACACCGACTGCCTGGACAAGAACGTCATCCACGCCGCCGCGTCGCAG
GGCAACACGCTCGTCATCGACGGCTGGTCGCATTCCCAGTCCTACGTGTCCGGCAAATGGACGCTGCAGG
ACTATAATTTCGAGACGCCCAGCACCGACCTCGCCGCCAGCACCACCACGGTCCTCGGTGTTTCCGCCTT
CAAGTCGCACGAGATGTTCGACTATCCCGGCGGCCATATGGTGAAGGCCGACGGCACCACCCTGTCCCGC
CTGCGCATGGAGGAGACGGAGACCGGCTATGAGCGGGTGGAGGGTACGGCGACCTACCGCGGCCTGTCCG
CCGGCGGCAAGATCTCCATGGCTGGCCATGCGGTGACGGCGGAGGTCGGCAAGGGCTATGTCATCACCGA
TCTGGCACTGAGCGCCCAGGACGAGACCCATCTCGGCAATGGTGGCATGCCCCCGCAATTCTCCTGCCGC
TTCGCCGCGATCCCGGAGGCCACGGTGTTCCGTCCGCCGCCGGTGCCGCGCCCTCGCACCCATGGTCCCG
ACACCGCGACCGTCGTCGGTCCCAGCGGCGAGGAGATCTATTGCGACAAGTACGGCCGCGTCCGGGTGCA
GTTCCATTGGGACCGCAAGGGCACCGACGACGAGAAGAGCTTTGTCTGGCTGCGCGTGGCCCAGACCATG
GCCGGCAAGAACTGGGGCACCATCTTCACCCCGCGCGTCGGCATGGAGGTGCTGGTCGACTATATCGGCG
GCGACCCCGACCGGCCGCTGATCGTCGGCTGCGTCTACAACGCCGAGAACATGCCGCCCTACACGCTGCC
CGACAACAAGACGCAGAGCGGCATCAAGACCCGTTCCAGCAAGGGCGGCGACACCGCGACCTTCAACGAA
CTGCGCTTCGAGGACAAGAAGGACGCGGAAGAGATCTATTTCCACGCCCAGAAGGACTTCAAGCGGGTGG
TGGAGAACGACGACACGCTGCAGGTCGACCACGACCAGACCATCACCATCAAGAACGACCGCACCGAAAC
GGTGTCGGAAGGCAACGAAACGGTCACCATCGCCAAGGGCAACCGCAGCGTCACTGTGTCGGAAGGCAAC
GACACCCATGACGTGACGAAGGGCAACCGGACCCTGACCGTCGGCGAAGGCAACCGCACCGTCACCGTCA
GCAAGGGCAACGATACCCACACGGTCAGCCAGGGCAACCGGACGGTGGACGTCGGGCAGGGCAACGACAG
CCTCACCGTCGGCCAGGGCAACATGGCGATCGACGTGAAGCAGGGCGACTACGCGCTGAAGCTCGGGCTG
GGCGACGTGTCGGTGAAGGCCAGCACCGGCAAGATCACCATGGAGGCGACGACCTCCATCGAGCTGAAGG
TCGGCGGCAACAGCGTCAAGATCGACCAGACCGGCATCACCGTCAAAGGCCTGATGGTCAAGGTCACCGG
CGACAGCCAGGTGCAGATCAAGGGTGCGATGACCCAGGTGAACGGTGATGCGATGGTCCAGGTCAAGGGC
GGCGTAGTAACCATCAATTGA