SecReT6
Protein ID: 374291555
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1020
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]951723..952979 [+]
Productputative SMAD/FHA domain; type VI secretion machinery component
NoteFha
UniProt IDG7Z5W7
KEGG IDali:AZOLI_1020
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.90E-13, Aligned region: 28..96
SPO11_like [PF03533], Evalue: 0.00019, Aligned region: 118..127
SPO11_like [PF03533], Evalue: 0.00019, Aligned region: 379..402
Protein Sequence: 418 a.a.     [Download]
>gi|374291555|ref|YP_005038590.1| putative SMAD/FHA domain; type VI secretion machinery component [Azospirillum lipoferum 4B]
MKLRLTLIQCPPAQGGDIARDLGTGRLVIGRGPDCDWVLNDPERMLSKIHCMVEFKGGVYIVIDSSTNGV
FLNDAPTPIGRGNSAVVGEGDRLRMGGFVMRAGFAAEEAPPANDPFLAVLRGSDEPAQSPAASPEDDPFA
LPAFGRGPMSVMPIPEDDDLFGDLPQPDTRWGGNSAGGWQPTAAGNASGGDPDWPGSTQTDFSPDSLGTI
RVSTGQAGFGAAKFDAGFDAGFHKGNGGSSIPDDWLDDPVDLPPATQPSNPPANPPAIPPDDWADEPLVP
PAFGARPSPFAAPSVNPVPADPAADALSRALVDVVLSLVRRQAALEAMLGLDPDDTMAQGDSILRRAVDA
DDALARLRALPLAEAEALLQAAVSDGAAHQSALLAAVRELTGETADGGTRLAALYRRLLPIHRHALGG
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|374290655|ref|NC_016622.1|:951723-952979 Azospirillum lipoferum 4B, complete genome
ATGAAGCTGCGCCTGACCCTGATCCAATGCCCGCCCGCGCAGGGTGGCGACATCGCCCGCGATCTCGGCA
CCGGCCGGCTGGTGATCGGCCGCGGTCCCGATTGCGACTGGGTGCTGAACGATCCGGAGCGGATGCTGTC
CAAGATCCACTGCATGGTGGAGTTCAAGGGTGGCGTCTACATCGTCATCGACAGTTCCACCAACGGCGTC
TTCCTGAACGACGCGCCGACCCCCATCGGCCGCGGCAACTCCGCCGTGGTGGGCGAGGGCGACCGGCTGC
GGATGGGCGGCTTCGTCATGCGCGCCGGCTTCGCCGCGGAGGAGGCGCCGCCCGCCAACGACCCCTTCCT
GGCGGTGCTGCGCGGCTCCGACGAACCGGCGCAGTCACCGGCGGCCTCGCCCGAGGACGATCCCTTCGCC
CTGCCGGCCTTCGGCCGCGGACCGATGTCGGTGATGCCGATTCCGGAGGATGACGACCTGTTCGGCGACC
TGCCGCAGCCGGACACGCGCTGGGGCGGCAATTCGGCTGGCGGCTGGCAGCCGACCGCGGCCGGAAACGC
CTCCGGCGGCGATCCCGACTGGCCGGGCTCCACCCAGACCGACTTCTCGCCGGACAGCCTCGGCACCATC
CGGGTGTCGACCGGGCAGGCGGGATTCGGCGCCGCCAAGTTCGATGCCGGCTTCGATGCCGGCTTCCACA
AGGGCAATGGCGGTTCGTCGATCCCCGACGACTGGCTGGACGATCCCGTCGACCTTCCGCCGGCCACCCA
GCCGTCGAACCCGCCTGCAAACCCGCCCGCCATTCCGCCTGACGATTGGGCCGACGAGCCGCTGGTCCCG
CCGGCCTTCGGCGCGCGTCCGTCGCCCTTCGCTGCGCCATCCGTCAACCCGGTTCCCGCCGATCCGGCCG
CCGACGCGCTCAGCCGCGCGCTGGTCGATGTCGTGCTGTCGCTGGTGCGGCGGCAGGCGGCGCTGGAGGC
CATGCTCGGCCTCGACCCGGACGACACGATGGCGCAGGGAGACTCGATCCTGCGCCGCGCCGTGGATGCC
GACGACGCGCTCGCCCGCCTGCGTGCCCTGCCGCTCGCCGAGGCGGAGGCGCTGTTGCAGGCGGCGGTGT
CCGACGGTGCGGCCCACCAGTCGGCCCTGCTGGCGGCGGTGCGCGAACTGACGGGGGAAACCGCCGACGG
CGGCACCCGGCTGGCCGCCCTGTACCGCCGGCTCCTGCCGATCCACCGCCACGCGCTGGGCGGCTGA