SecReT6
Protein ID: 374291556
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_1021
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]953035..954369 [+]
Producthypothetical protein
NoteTssK
UniProt IDG7Z5W8
KEGG IDali:AZOLI_1021
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-155, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|374291556|ref|YP_005038591.1| hypothetical protein AZOLI_1021 [Azospirillum lipoferum 4B]
MSWDDKVIWSEGMFLRAQHFQQQDRYVERLVRGRVGGIRPFAWGISELTINRELLAVGKFAVLRCKGILE
DGTPINIPDDDDPPPPLDLPETLANSIVYLALPIRQRGGVEFEVGESADAATRYVGEETETVDAIAGSAS
VSRIRTGRLRLRYRLERQERAGYHCLGLARIQEVRSDRQATLDERYIPPALNVQALAPLAGFVTEIQGLL
NSRSEALAARVGGSNGRGAGEMADFLMLQVANRSEPLFANIARMPDIHPERLHGMMLGLAGELATFTAVN
KRPPSFPPYRHEDLQGTLEPVMAEIRRSLSAVLEQTAIPIDLQERKYGIRVGTIADRSLITTATFVLAVR
ADMPGEALRRNFPALVKIGPVEQIRELVNVQLPGIRVRPLPVALRQLPYHAGAVYFELERGSPIWKQLAT
SGGIAVHLAGDFPQVAMELWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|374290655|ref|NC_016622.1|:953035-954369 Azospirillum lipoferum 4B, complete genome
ATGAGTTGGGACGACAAGGTCATCTGGTCCGAAGGCATGTTCCTGCGGGCGCAGCATTTCCAGCAGCAGG
ACCGCTATGTCGAGCGGCTGGTGCGCGGCCGTGTCGGCGGCATCCGCCCCTTCGCCTGGGGCATCAGCGA
ACTGACGATCAACCGCGAGCTTCTGGCCGTCGGCAAGTTCGCCGTCCTGCGCTGCAAGGGCATCCTGGAG
GACGGGACGCCGATCAACATCCCCGACGACGACGATCCGCCGCCGCCGCTCGACCTGCCGGAAACGCTGG
CCAACAGCATCGTCTATCTGGCCCTGCCCATCCGCCAGCGCGGCGGCGTGGAATTCGAGGTGGGCGAGAG
CGCCGACGCGGCCACCCGCTATGTCGGTGAGGAGACGGAGACGGTCGACGCCATCGCCGGGTCGGCCAGC
GTGTCGCGCATCCGCACCGGACGGCTGCGCCTGCGCTACCGGCTGGAGCGGCAGGAGCGCGCCGGCTACC
ACTGCCTGGGCCTCGCCCGCATCCAGGAGGTGCGGTCGGACCGCCAGGCCACGCTGGACGAGCGCTATAT
CCCGCCGGCCCTGAACGTCCAGGCGCTGGCCCCGCTGGCCGGCTTCGTCACCGAGATCCAGGGGTTGCTG
AACAGCCGGTCGGAAGCGCTGGCCGCGCGTGTCGGCGGGTCCAACGGGCGCGGCGCCGGCGAGATGGCCG
ACTTCCTGATGCTGCAGGTCGCCAACCGCTCGGAACCGCTGTTCGCCAACATCGCCCGCATGCCCGACAT
CCATCCGGAACGGCTGCACGGCATGATGCTGGGGCTGGCCGGCGAACTGGCGACCTTCACCGCCGTCAAC
AAGCGGCCGCCCAGCTTCCCGCCCTACCGCCACGAGGATCTGCAGGGCACGCTCGAACCGGTGATGGCGG
AGATCCGCCGCTCGCTGAGCGCGGTGCTGGAACAGACCGCCATTCCCATCGACCTGCAGGAGCGCAAATA
CGGCATCCGCGTCGGCACCATCGCCGACCGTTCGCTGATCACTACGGCGACCTTCGTGCTGGCGGTGCGG
GCGGACATGCCGGGCGAGGCGTTGCGCCGCAACTTCCCCGCGCTGGTCAAGATCGGCCCGGTGGAGCAAA
TTCGCGAACTGGTCAATGTACAGTTGCCCGGAATCCGAGTAAGGCCGCTGCCTGTCGCTCTGCGCCAGCT
GCCCTACCATGCAGGTGCCGTGTATTTCGAGCTCGAACGGGGTAGCCCGATTTGGAAACAGCTTGCAACT
TCGGGCGGAATCGCGGTTCATCTAGCGGGTGATTTCCCCCAGGTGGCGATGGAGCTTTGGGCGATCCGTG
GCTGA