SecReT6
Protein ID: 374293932
SecReT6 ID526
T6SS typeN/A
Gene symbolclpB2
Locus tagAZOLI_p30461
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]491600..494284 [-]
ProductATP-dependent chaperone
NoteTssH
UniProt IDG7ZFH1
KEGG IDali:AZOLI_p30461
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-54, Aligned region: 205..283
AAA_2 [PF07724], Evalue: 2.00E-54, Aligned region: 595..758
AAA [PF00004], Evalue: 2.50E-23, Aligned region: 206..318
AAA [PF00004], Evalue: 2.50E-23, Aligned region: 601..719
ClpB_D2-small [PF10431], Evalue: 1.60E-22, Aligned region: 765..842
Clp_N [PF02861], Evalue: 1.30E-18, Aligned region: 17..68
Clp_N [PF02861], Evalue: 1.30E-18, Aligned region: 101..147
AAA_5 [PF07728], Evalue: 7.40E-18, Aligned region: 206..284
AAA_5 [PF07728], Evalue: 7.40E-18, Aligned region: 600..718
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 203..323
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 330..418
AAA_22 [PF13401], Evalue: 1.20E-10, Aligned region: 598..694
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 17..74
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 114..165
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 183..227
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 244..291
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 471..519
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 569..634
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 664..695
IstB_IS21 [PF01695], Evalue: 1.40E-08, Aligned region: 106..123
IstB_IS21 [PF01695], Evalue: 1.40E-08, Aligned region: 200..266
IstB_IS21 [PF01695], Evalue: 1.40E-08, Aligned region: 600..636
IstB_IS21 [PF01695], Evalue: 1.40E-08, Aligned region: 710..735
Sigma54_activat [PF00158], Evalue: 1.50E-07, Aligned region: 184..286
Sigma54_activat [PF00158], Evalue: 1.50E-07, Aligned region: 581..700
Mg_chelatase [PF01078], Evalue: 1.70E-06, Aligned region: 189..236
Mg_chelatase [PF01078], Evalue: 1.70E-06, Aligned region: 598..624
Mg_chelatase [PF01078], Evalue: 1.70E-06, Aligned region: 672..699
AAA_18 [PF13238], Evalue: 1.90E-06, Aligned region: 207..273
AAA_18 [PF13238], Evalue: 1.90E-06, Aligned region: 602..630
AAA_25 [PF13481], Evalue: 2.80E-06, Aligned region: 206..242
AAA_25 [PF13481], Evalue: 2.80E-06, Aligned region: 259..298
AAA_25 [PF13481], Evalue: 2.80E-06, Aligned region: 581..672
AAA_19 [PF13245], Evalue: 3.20E-06, Aligned region: 203..232
AAA_19 [PF13245], Evalue: 3.20E-06, Aligned region: 603..623
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 207..283
AAA_17 [PF13207], Evalue: 3.60E-06, Aligned region: 604..661
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 185..287
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 601..621
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 664..682
Arch_ATPase [PF01637], Evalue: 4.50E-06, Aligned region: 745..798
RuvB_N [PF05496], Evalue: 8.30E-06, Aligned region: 175..226
RuvB_N [PF05496], Evalue: 8.30E-06, Aligned region: 262..286
RuvB_N [PF05496], Evalue: 8.30E-06, Aligned region: 561..619
RuvB_N [PF05496], Evalue: 8.30E-06, Aligned region: 669..706
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 206..235
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 602..619
AAA_23 [PF13476], Evalue: 0.00017, Aligned region: 206..238
AAA_23 [PF13476], Evalue: 0.00017, Aligned region: 433..489
AAA_23 [PF13476], Evalue: 0.00017, Aligned region: 598..633
AAA_28 [PF13521], Evalue: 0.00024, Aligned region: 206..225
AAA_28 [PF13521], Evalue: 0.00024, Aligned region: 389..435
AAA_28 [PF13521], Evalue: 0.00024, Aligned region: 600..638
AAA_3 [PF07726], Evalue: 0.00028, Aligned region: 207..227
AAA_3 [PF07726], Evalue: 0.00028, Aligned region: 670..716
Zeta_toxin [PF06414], Evalue: 0.00035, Aligned region: 205..229
Zeta_toxin [PF06414], Evalue: 0.00035, Aligned region: 319..338
Zeta_toxin [PF06414], Evalue: 0.00035, Aligned region: 599..641
RNA_helicase [PF00910], Evalue: 0.00051, Aligned region: 207..227
RNA_helicase [PF00910], Evalue: 0.00051, Aligned region: 601..622
ResIII [PF04851], Evalue: 0.0012, Aligned region: 190..239
ResIII [PF04851], Evalue: 0.0012, Aligned region: 271..288
ResIII [PF04851], Evalue: 0.0012, Aligned region: 571..620
T2SE [PF00437], Evalue: 0.0012, Aligned region: 199..226
T2SE [PF00437], Evalue: 0.0012, Aligned region: 589..678
AAA_33 [PF13671], Evalue: 0.0015, Aligned region: 91..143
AAA_33 [PF13671], Evalue: 0.0015, Aligned region: 206..226
AAA_33 [PF13671], Evalue: 0.0015, Aligned region: 601..626
AAA_29 [PF13555], Evalue: 0.0047, Aligned region: 200..222
AAA_29 [PF13555], Evalue: 0.0047, Aligned region: 597..622
DUF258 [PF03193], Evalue: 0.0048, Aligned region: 201..226
DUF258 [PF03193], Evalue: 0.0048, Aligned region: 600..619
Sigma54_activ_2 [PF14532], Evalue: 0.005, Aligned region: 189..224
Sigma54_activ_2 [PF14532], Evalue: 0.005, Aligned region: 580..620
ABC_tran [PF00005], Evalue: 0.0059, Aligned region: 206..226
ABC_tran [PF00005], Evalue: 0.0059, Aligned region: 602..629
DUF815 [PF05673], Evalue: 0.0063, Aligned region: 191..283
DUF815 [PF05673], Evalue: 0.0063, Aligned region: 596..625
MMR_HSR1 [PF01926], Evalue: 0.0068, Aligned region: 206..281
MMR_HSR1 [PF01926], Evalue: 0.0068, Aligned region: 601..626
AAA_10 [PF12846], Evalue: 0.0075, Aligned region: 229..290
AAA_10 [PF12846], Evalue: 0.0075, Aligned region: 598..633
NTPase_1 [PF03266], Evalue: 0.0082, Aligned region: 207..231
NTPase_1 [PF03266], Evalue: 0.0082, Aligned region: 604..628
NTPase_1 [PF03266], Evalue: 0.0082, Aligned region: 839..867
Protein Sequence: 894 a.a.     [Download]
>gi|374293932|ref|YP_005040955.1| ATP-dependent chaperone [Azospirillum lipoferum 4B]
MDFGQFTDRARSAIQAAQIAALAERHQQLLPEHLLKALIDDASGVAARLVRDTGGDPDLLKSATEEQLSR
APVQPGANEGPQPLYMSPALAAVLQGAVASARNGGDRFVTAERLLESLARQSGPLRALFRRAGVDADALA
AAADAQRKDHPADAETETTSGEALARYTRDLTEEARQGRLDPVIGRDDEIRRTIQVLARRTKNNPVLIGE
PGVGKTAVVEGLAQRLASGDVPEGLKDRRVLALDLTALLAGAKFRGEFEERLKSVLSEVQEANGRIILFI
DELHTLIGAGRTDGAMDAANMLKPALARGELRCVGATTPDEYRKYIEKDAALARRFQPVTVDEPSVDDAV
SILRGIKGKYEVHHGVRIADAAVVAAVNLSARYIGDRRLPDKAIDLVDEAASRLRMAIDSKPEALDAVDR
RVAQLKIEREALKAEPDAASQERLHVLEGELVEAEARQSSMEEEWRASQSRRTEGRRLKEELDQARTRLE
RAQRDGDWAKAGELAYGVVPDLEKRLAEAESRASTERDEVTAKDIGAVVTRWTGIPVERMLEGERQRLKG
MEDKLAERVVGQKEAVRAVSKAVRRARAGLKDPSRPTGSFLFLGPTGVGKTELAKALAAFLFDDETAITR
LDMSEYMEKHAVSRMIGSPPGYVGYDDGGSLAERIRRRPYQVVLLDEVEKAHPDVLNVLLQALDDGRLTD
GQGRTADFRHAILIMTSNLGAEALSALGDDEDMAGVTVEVMDAVRKAFRPEFLNRLDDVLIFRRLGRDQM
SRIVDIQLARVNERLAERGVTLAADAAAKRRLGDLGWDPAFGARPLKRAIQGLVEDPIAERLLDEEVEGK
TTMTLSVVDGRLALDGVVVEEDRAHGFKAPERPPLGFALPPVASSANGREASVH
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|374293519|ref|NC_016623.1|:c494284-491600 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGGACTTCGGTCAATTCACCGATCGTGCGCGCAGTGCCATTCAGGCCGCGCAGATCGCCGCCCTTGCCG
AGCGGCATCAACAGCTTCTCCCCGAACATCTGCTGAAGGCGCTGATCGACGACGCCAGCGGCGTGGCGGC
GCGTCTGGTGCGCGATACCGGCGGCGATCCCGACCTGCTGAAGTCCGCGACCGAGGAACAGCTGTCGCGC
GCTCCGGTCCAGCCGGGTGCCAACGAAGGCCCGCAGCCGCTCTACATGTCGCCGGCGCTGGCCGCCGTGC
TGCAGGGCGCCGTCGCCTCGGCGCGCAACGGCGGCGACCGCTTCGTCACCGCCGAACGGCTGCTGGAAAG
CCTCGCCCGCCAGAGCGGCCCGCTGCGCGCCCTGTTCCGCCGCGCCGGCGTCGATGCCGACGCGCTGGCC
GCCGCCGCCGATGCCCAGCGCAAGGACCATCCCGCCGACGCGGAGACCGAAACCACCTCCGGCGAGGCGC
TGGCCCGCTACACCCGCGACCTGACGGAAGAGGCGCGGCAGGGCCGGCTCGACCCGGTGATCGGCCGTGA
CGACGAGATCCGCCGCACCATCCAGGTCCTGGCCCGCCGCACCAAGAACAACCCCGTGCTGATCGGCGAG
CCCGGCGTCGGCAAGACCGCCGTGGTCGAGGGGCTGGCCCAGCGTCTGGCCTCCGGCGACGTGCCGGAAG
GGCTGAAGGACCGGCGCGTCCTGGCGCTCGACCTCACCGCGCTGCTGGCCGGCGCCAAGTTCCGCGGCGA
GTTCGAGGAGCGGCTGAAGTCGGTCCTGAGCGAGGTGCAGGAGGCCAACGGCCGCATCATCCTGTTCATC
GACGAGCTGCACACCCTGATCGGCGCCGGCCGCACCGACGGGGCGATGGACGCCGCCAACATGCTGAAGC
CCGCGCTGGCGCGCGGCGAGCTGCGCTGCGTCGGCGCCACCACGCCGGACGAGTACCGCAAATACATCGA
GAAGGACGCGGCGCTCGCCCGTCGCTTCCAGCCGGTGACGGTTGACGAGCCGTCGGTGGACGACGCCGTG
TCGATCCTGCGCGGCATCAAGGGCAAGTACGAGGTGCACCACGGCGTGCGCATCGCCGACGCGGCGGTGG
TCGCGGCGGTCAACCTGTCGGCGCGCTACATCGGCGACCGCCGGCTGCCCGACAAGGCCATCGACCTCGT
CGACGAGGCGGCGAGCCGCCTGCGCATGGCCATCGACAGCAAGCCGGAGGCGCTCGACGCCGTCGACCGC
CGCGTCGCCCAGCTGAAGATCGAACGCGAGGCGCTGAAGGCCGAGCCGGACGCCGCCTCGCAGGAACGGC
TGCACGTCCTGGAAGGCGAACTGGTCGAGGCGGAAGCCCGCCAGTCCTCGATGGAGGAGGAGTGGCGCGC
CTCGCAGTCCCGCCGCACCGAGGGCCGCCGCCTGAAGGAGGAGCTTGACCAGGCCCGCACCAGGCTGGAG
CGCGCCCAGCGCGACGGCGACTGGGCCAAGGCCGGCGAGCTGGCCTATGGCGTGGTGCCCGACCTGGAGA
AGCGTCTGGCCGAGGCCGAATCGCGCGCCAGCACCGAGCGTGACGAGGTGACGGCCAAGGACATCGGCGC
CGTCGTCACCCGCTGGACCGGCATCCCGGTCGAACGGATGCTGGAAGGCGAACGCCAGCGGCTGAAGGGC
ATGGAGGACAAGCTGGCGGAGCGCGTCGTCGGCCAGAAGGAGGCGGTGCGCGCGGTGTCCAAGGCGGTGC
GGCGTGCCCGTGCCGGGCTGAAGGACCCCAGCCGGCCGACCGGTTCCTTCCTGTTCCTCGGCCCCACCGG
CGTCGGCAAGACCGAGCTGGCCAAGGCGCTGGCCGCCTTCCTGTTCGACGACGAGACGGCGATCACCCGC
CTCGACATGTCGGAGTATATGGAGAAGCACGCGGTCAGCCGCATGATCGGCTCGCCGCCGGGCTATGTCG
GCTATGACGACGGCGGCTCGCTGGCCGAACGCATCCGGCGCCGGCCCTATCAGGTCGTGCTGCTGGACGA
GGTGGAGAAGGCCCATCCCGACGTGCTGAACGTCCTGCTGCAGGCGCTCGACGATGGGCGGCTGACCGAC
GGGCAGGGCCGCACCGCCGATTTCCGCCACGCCATCCTCATCATGACCTCCAACCTGGGGGCCGAGGCGC
TGAGCGCCTTGGGCGACGACGAGGACATGGCCGGCGTGACGGTGGAGGTGATGGACGCGGTGCGCAAGGC
CTTCCGGCCGGAATTCCTCAACCGGTTGGACGATGTCCTGATCTTCCGCCGGCTGGGCCGGGACCAGATG
TCGCGGATCGTCGATATCCAGCTGGCTCGCGTCAACGAGCGGCTGGCCGAGCGCGGCGTCACCCTGGCGG
CGGACGCCGCAGCCAAGCGGCGGCTCGGCGATCTGGGCTGGGATCCGGCCTTCGGCGCCCGTCCGCTGAA
GCGCGCCATCCAGGGCCTTGTCGAGGATCCCATCGCCGAGCGCCTGCTCGACGAGGAGGTGGAGGGCAAG
ACCACCATGACCCTGTCGGTCGTCGATGGCCGGCTGGCTCTGGACGGCGTCGTGGTCGAGGAGGACCGCG
CCCACGGCTTCAAGGCGCCGGAGCGTCCGCCGCTGGGCTTCGCCCTGCCGCCGGTGGCAAGTTCCGCCAA
CGGACGGGAGGCATCGGTCCACTGA