SecReT6
Protein ID: 374293936
SecReT6 ID526
T6SS typeN/A
Gene symbol-
Locus tagAZOLI_p30466
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]496629..497300 [-]
Productputative outer membrane protein, OmpA family
NoteTagL
UniProt IDG7ZEP1
KEGG IDali:AZOLI_p30466
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.60E-18, Aligned region: 119..213
Protein Sequence: 223 a.a.     [Download]
>gi|374293936|ref|YP_005040959.1| putative outer membrane protein, OmpA family [Azospirillum lipoferum 4B]
MAPALPESDIGDRGMGTVRVLRPAFAGLALLLALPMAFGGVAAATEPTAAPTTSEDFIRALRPDTPPSDE
MPNEKPRTRGLALGTGGAGEPPPPPSPSAPAPTAMKPKTAPRISFQVEFAFNSAELTPKAAGILDELGRA
LTSPDLAAYRFQLTGHTDGVGNPDYNLALSKRRAASVRDYLTRRFGVSSGRLVAIGRGSQQLLDPANPAS
DANRRVEIVNLGS
 
Nucleotide Sequence: 672 bp     [Download]
>gi|374293519|ref|NC_016623.1|:c497300-496629 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGGCGCCGGCTTTGCCCGAATCGGACATAGGGGACAGGGGAATGGGGACGGTCAGGGTCTTGCGGCCGG
CATTTGCCGGATTGGCGTTGTTGCTGGCGCTGCCGATGGCGTTTGGCGGCGTGGCGGCGGCCACCGAACC
GACCGCCGCCCCCACCACGTCGGAGGATTTCATCCGGGCCCTGCGGCCGGACACGCCGCCGTCCGACGAG
ATGCCAAACGAGAAGCCCAGAACCCGCGGCCTCGCGCTCGGCACCGGTGGCGCTGGCGAACCGCCGCCAC
CCCCGTCTCCATCGGCGCCCGCCCCCACCGCCATGAAGCCGAAGACGGCCCCGAGGATCAGCTTCCAGGT
GGAGTTCGCCTTCAACTCGGCGGAACTGACACCGAAGGCCGCCGGCATCCTCGACGAGCTGGGCCGCGCC
CTGACCTCTCCGGATCTGGCGGCCTACCGCTTCCAGCTGACCGGCCACACCGACGGCGTCGGCAATCCCG
ATTACAACCTCGCTTTGTCGAAGCGGCGGGCCGCGTCGGTGCGCGATTACCTGACCCGGAGATTCGGCGT
GTCGTCCGGCCGGCTGGTGGCCATCGGCCGCGGATCGCAGCAGCTGCTCGACCCCGCCAACCCGGCCAGC
GACGCCAACCGCCGGGTTGAGATCGTCAATCTCGGCTCCTGA