SecReT6
Protein ID: 374293950
SecReT6 ID526
T6SS typeN/A
Gene symbol-
Locus tagAZOLI_p30482
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]515660..517045 [+]
Producthypothetical protein
NoteTssL
UniProt IDG7ZEP7
KEGG IDali:AZOLI_p30482
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-56, Aligned region: 63..267
DUF2077 [PF09850], Evalue: 2.20E-56, Aligned region: 333..371
OmpA [PF00691], Evalue: 2.50E-11, Aligned region: 352..453
Protein Sequence: 461 a.a.     [Download]
>gi|374293950|ref|YP_005040973.1| hypothetical protein AZOLI_p30482 [Azospirillum lipoferum 4B]
MQGGDEFGGMPGPETERTVLMPTPGGRRASGAPGGGEPPAAARVEAVGVPGPALAGIFAARSPLAAAASP
VLLLAARLNDVTGVPDLESLRQRVISALRDFQHWVTKSGMDAATQATSHYALCALIDDIVLNSQWGSQSS
WTRQNVTSMFHKNVVGGDQFYERLASARQDPGKYGDLLELMYLCLSLGFRGRYRVAGRQDSEHARIREDV
YNILVKHRGYADRILCPNAAALAMDYRPPRSSLPVWVAGAGTALFLLLLFLALSFLLNGASDRLFAGMGG
LPPHGGVVIEAPAPVKLAEAAPPPPQIAPPPPPQTTQVQRVRKFLEPEIAEGLVEVTEDALSITVRMRGS
NLFASGSAGLNDKVRASVLRVGRAVAEEPGAVLITGHTDNVPITGGGRLRFPSNWHLSKARAESVMAEFD
PLFADKSRLKAEGKSDTEPVASNDTPEGRAANRRIDIILRK
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|374293519|ref|NC_016623.1|:515660-517045 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGCAAGGCGGCGATGAGTTTGGCGGCATGCCCGGACCGGAGACGGAACGCACGGTCCTGATGCCGACGC
CGGGTGGCCGGCGCGCATCCGGTGCTCCCGGCGGCGGGGAACCGCCTGCCGCGGCGCGGGTGGAGGCTGT
CGGCGTGCCGGGACCGGCGCTGGCCGGCATCTTCGCCGCCCGGTCGCCGCTTGCCGCCGCCGCCTCGCCG
GTTCTGCTGCTGGCGGCGCGGCTGAACGACGTGACCGGGGTGCCGGATCTGGAATCGCTGCGCCAGCGCG
TGATCTCCGCCCTGCGCGACTTCCAGCATTGGGTGACCAAGTCCGGCATGGACGCCGCGACCCAGGCGAC
CTCCCATTACGCGCTCTGCGCCCTGATCGACGACATCGTGCTGAACTCGCAATGGGGCAGCCAGAGTTCC
TGGACGCGCCAGAACGTCACCAGCATGTTCCACAAGAACGTCGTCGGCGGCGACCAGTTCTATGAACGGC
TCGCCTCCGCCCGGCAGGATCCGGGCAAGTACGGCGACCTGCTGGAGCTGATGTATCTCTGCCTGTCGCT
GGGCTTCCGCGGCCGCTACCGCGTCGCCGGCCGGCAGGACAGCGAGCATGCCCGCATCCGCGAGGACGTC
TACAACATCCTGGTCAAGCATCGCGGCTATGCCGACCGCATCCTCTGCCCGAACGCGGCGGCGCTGGCGA
TGGACTATCGTCCGCCGCGCAGTTCGCTGCCGGTCTGGGTGGCCGGGGCCGGCACCGCGCTGTTCCTGCT
GCTGCTGTTCCTGGCGCTGAGCTTTCTGCTGAACGGCGCGTCGGACCGGCTGTTCGCCGGCATGGGCGGC
CTGCCGCCGCATGGCGGCGTGGTGATCGAGGCGCCGGCCCCGGTCAAGCTGGCCGAAGCCGCACCGCCGC
CGCCGCAGATCGCCCCGCCGCCGCCGCCGCAGACCACGCAGGTTCAGCGCGTGCGCAAGTTCCTGGAGCC
GGAGATCGCCGAAGGGCTGGTCGAGGTGACGGAGGATGCGCTGTCCATCACCGTGCGCATGCGCGGCAGC
AACCTGTTCGCCAGCGGCAGCGCCGGGCTGAACGACAAGGTGCGGGCATCGGTGCTGCGCGTCGGCCGCG
CCGTGGCGGAGGAGCCGGGCGCGGTGCTGATCACCGGGCATACCGACAATGTGCCGATCACCGGCGGCGG
GCGGCTGCGCTTCCCGTCGAACTGGCACCTGTCGAAGGCCCGCGCCGAATCCGTGATGGCGGAGTTCGAC
CCGCTCTTCGCCGACAAGTCCCGCCTGAAGGCGGAGGGCAAGTCCGATACCGAGCCGGTGGCGTCCAACG
ACACGCCCGAAGGCCGGGCGGCGAACCGCCGGATCGACATCATTCTCAGGAAATGA