SecReT6
Protein ID: 374293953
SecReT6 ID526
T6SS typeN/A
Gene symbol-
Locus tagAZOLI_p30485
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]521206..523269 [+]
Productputative type VI secretion protein Vgr-like
NoteTssI
UniProt IDG7ZEQ0
KEGG IDali:AZOLI_p30485
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-66, Aligned region: 29..334
Phage_base_V [PF04717], Evalue: 1.00E-23, Aligned region: 374..462
Protein Sequence: 687 a.a.     [Download]
>gi|374293953|ref|YP_005040976.1| putative type VI secretion protein Vgr-like [Azospirillum lipoferum 4B]
MQFVQDDRLLSLETPAGPDVLLVERVQGREALSSPFLYRIDALGPIEPLAAETIVGNSVNIGFRQLDGER
HYVNGIARSLGVGVPVGRDQRYYTIEVVPWLSLLSYTSDCRIFHSLGGGGPTTVPKIVETIFQEFGFSNF
EFRSLSGTYQPREYCVQYNETYFDFISRLLEEEGIYYYFAHERDRHKLILSDSAAGYAKLSPATLRFNPS
GQYADQIERWERVYSIASGRWATKDYDFQAPRTALDSGEASVAKVPVSTKYELFEYPGRYATRDAGSALA
RRRMETEERGLEGVRGTGACRSLHPGMVFALTDHPTAAENNQPVVVAELEFDACNEGFLPGDKRKASYGN
SFRALPAKAVVRPARRTPKPSVRGIQTAFVVGPAGEEIYTDKFGRIMVQFHWDRRGRSDEKSSCWIRVAQ
SWAGHQWGMQTVPRIGMEVLVDFVDGDPDRPMVIGVVNNADALPTYALPEHKTRSGIKTRSSPGGRGFNE
IRFEDKAGKEQVFVHAQRDYDLRIGHDSRSSVASGQHVNVAGGLWEWVGKNHHATVDGDHVESIGGGVSR
TVGVDLHDKIGTNYAVNAGANLCLEAGASLTLKVGGNFITLSPAGIAMNGTMVLINSGGAANGLSASPAK
PDKPSPADKDKGGTIPAPPKAKLPRPAQSHTPKAAAQAMVMRSAAASNTPLCEICQT
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|374293519|ref|NC_016623.1|:521206-523269 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGCAGTTCGTTCAGGACGACCGCCTGCTGTCGCTGGAAACGCCTGCCGGCCCCGACGTGCTGCTGGTGG
AGCGGGTGCAGGGGCGCGAGGCGCTGTCCAGCCCCTTCCTCTACCGCATCGACGCGCTGGGACCCATCGA
GCCGCTGGCAGCCGAGACCATCGTCGGCAACAGCGTCAACATCGGCTTCCGGCAACTGGACGGCGAGCGC
CACTATGTCAACGGCATCGCGCGCTCGCTCGGCGTCGGCGTGCCGGTGGGGCGCGACCAGCGTTACTACA
CCATCGAGGTGGTGCCCTGGCTGTCGCTGCTGTCCTACACCAGCGATTGCCGCATCTTCCACAGCCTGGG
CGGAGGCGGGCCGACGACGGTGCCGAAGATCGTCGAGACGATCTTCCAGGAATTCGGCTTCTCCAACTTC
GAATTCCGCAGCCTGAGCGGCACCTACCAGCCGCGCGAATATTGCGTCCAGTACAACGAGACCTATTTCG
ACTTCATCAGCCGGCTGCTGGAAGAAGAGGGCATCTATTATTACTTCGCGCATGAGCGCGACCGGCACAA
GCTGATCCTGTCCGACAGCGCCGCCGGCTATGCCAAGCTGTCGCCGGCCACCCTGCGCTTCAACCCCAGC
GGCCAGTATGCCGACCAGATCGAGCGGTGGGAGCGGGTCTATTCCATCGCGTCGGGCCGCTGGGCGACCA
AGGACTACGATTTCCAGGCTCCGCGCACGGCGCTGGACAGCGGCGAGGCGTCGGTCGCCAAGGTGCCGGT
TTCGACCAAATACGAGCTGTTCGAATATCCCGGCCGCTATGCCACGCGCGACGCCGGATCGGCGCTCGCC
CGCCGCCGGATGGAGACGGAGGAGCGCGGGCTGGAGGGGGTGCGCGGCACCGGTGCCTGCCGCAGCCTGC
ACCCCGGCATGGTTTTCGCCCTGACCGACCATCCGACGGCGGCGGAGAACAACCAGCCCGTCGTGGTGGC
GGAGCTGGAGTTCGACGCCTGCAACGAGGGCTTCCTGCCCGGCGACAAGCGCAAGGCGTCCTACGGCAAC
AGCTTCCGCGCCCTGCCGGCGAAGGCGGTGGTGCGGCCGGCGCGGCGCACGCCCAAGCCGTCGGTGCGCG
GCATCCAGACCGCCTTCGTCGTCGGCCCGGCGGGGGAGGAGATCTACACCGACAAGTTCGGCCGCATCAT
GGTGCAGTTCCATTGGGACCGCCGCGGCCGGTCGGACGAGAAAAGCTCCTGCTGGATCCGGGTGGCGCAA
AGCTGGGCCGGGCACCAATGGGGCATGCAGACGGTGCCGCGCATCGGCATGGAAGTGCTGGTCGATTTCG
TCGACGGCGATCCCGACCGGCCGATGGTGATCGGCGTGGTCAACAACGCCGACGCGCTGCCGACCTACGC
CCTGCCCGAACACAAGACGCGCTCCGGCATCAAGACGCGCAGCTCGCCCGGCGGGCGCGGCTTCAACGAG
ATCCGCTTCGAGGACAAGGCGGGCAAGGAGCAGGTCTTCGTCCATGCCCAGCGCGACTACGACCTGCGCA
TCGGCCATGACAGCCGCAGCTCGGTGGCGTCCGGCCAGCATGTGAACGTCGCCGGCGGCCTGTGGGAATG
GGTGGGCAAGAACCATCACGCCACGGTGGACGGCGACCATGTGGAGTCCATCGGCGGCGGCGTGTCGCGC
ACGGTCGGCGTCGACCTGCACGACAAGATCGGCACCAACTATGCCGTCAATGCCGGGGCGAATTTGTGCC
TGGAGGCCGGCGCCTCGCTGACGCTGAAGGTCGGCGGCAACTTCATCACGCTGAGCCCGGCCGGCATCGC
CATGAACGGCACCATGGTGCTGATCAACAGCGGCGGTGCGGCCAACGGGCTGAGCGCCTCGCCGGCCAAG
CCGGACAAGCCGTCGCCGGCCGACAAGGACAAGGGCGGGACGATCCCGGCCCCGCCGAAGGCCAAGCTGC
CGCGCCCGGCGCAAAGTCACACCCCGAAGGCCGCGGCCCAGGCCATGGTGATGCGCAGCGCCGCCGCGTC
CAACACGCCGCTGTGCGAGATCTGCCAGACATGA