SecReT6
Protein ID: 374293955
SecReT6 ID526
T6SS typeN/A
Gene symbol-
Locus tagAZOLI_p30487
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]523938..524228 [+]
Producthypothetical protein
NotePAAR
UniProt IDG7ZFI2
KEGG IDali:AZOLI_p30487
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.80E-22, Aligned region: 3..19
PAAR_motif [PF05488], Evalue: 5.80E-22, Aligned region: 17..88
PAAR_motif [PF05488], Evalue: 5.80E-22, Aligned region: 76..96
DUF4150 [PF13665], Evalue: 0.00015, Aligned region: 3..11
DUF4150 [PF13665], Evalue: 0.00015, Aligned region: 31..50
DUF4150 [PF13665], Evalue: 0.00015, Aligned region: 58..81
Protein Sequence: 96 a.a.     [Download]
>gi|374293955|ref|YP_005040978.1| hypothetical protein AZOLI_p30487 [Azospirillum lipoferum 4B]
MPPAARLTDMHSCPMTTGPVPHVGGPIVSPGVPAVLIEFLPAAVVTDMCVCVGPPDVIVKGSATVMVGGR
PAARLGDQTAHGGVIVTGAPTVVVGG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|374293519|ref|NC_016623.1|:523938-524228 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGCCGCCCGCCGCGCGCCTGACCGACATGCACAGCTGCCCGATGACGACCGGCCCGGTCCCGCATGTCG
GCGGCCCCATCGTCAGCCCCGGCGTGCCGGCGGTCCTGATCGAGTTCCTGCCGGCCGCGGTGGTCACCGA
CATGTGCGTCTGCGTCGGCCCGCCCGACGTGATCGTGAAGGGATCGGCGACGGTGATGGTCGGCGGCCGG
CCGGCGGCACGGCTGGGCGACCAGACCGCCCATGGCGGGGTGATCGTCACCGGGGCGCCGACGGTGGTGG
TCGGCGGCTGA