SecReT6
Protein ID: 374293956
SecReT6 ID526
T6SS typeN/A
Gene symbol-
Locus tagAZOLI_p30488
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]524271..525887 [+]
Productputative type VI secretion protein, FHA domain-containing
NoteFha
UniProt IDG7ZFI3
KEGG IDali:AZOLI_p30488
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.60E-13, Aligned region: 28..96
Protein Sequence: 538 a.a.     [Download]
>gi|374293956|ref|YP_005040979.1| putative type VI secretion protein, FHA domain-containing [Azospirillum lipoferum 4B]
MLRLRIVSDHRASLGGNAEKTLHGGDLTVGRGVENGWILPDPDLLLSRQHCVFEKTAAGYRVIDTSTNGV
FLNGSDRPLGRNVPAALGSGDRIRIGRFIIEATVETLSAPSFTEISGAFRLGGTDSAPDPFAPDPFAPPP
PAAAAPDRFDELFADPLAGSVEQRPFEHRPLRSEEAPFDAWTASSSGAAPRERADDWRFGTVDDHSDPLN
QSLSIGVSYQPPAAAPPPSGGGIPDDWDDELFAPPKPAASTVPHPAFPAAAKTAQPLPEDWNIDETLPDP
AADPLPAEPSPVARVAEPIPLPDDSVIVPHAVPQVVPPPPAPVSPPAPLAAPVTDAGAAVAAFYEGFGAP
LPADGLPDPTATMRNLGEALRVSLGALHASLRARSRFKDEFHLEQTSFRPAGENPLKRCETLDEAVSVLA
NPRLRGFLPMADAVREAASDVQVHHLAYAAALQTALKQVVAKFDPGALSQRLETRLLDSIVPAARKARYW
DQYETLYKDLVVELEEDFDRVIGDAIAREYDRFVRGDTGRDPEGGSPD
 
Nucleotide Sequence: 1617 bp     [Download]
>gi|374293519|ref|NC_016623.1|:524271-525887 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGCTGAGGCTGAGGATCGTTTCGGACCATCGGGCGTCGCTGGGCGGCAATGCCGAGAAGACGCTGCATG
GCGGCGACCTCACCGTCGGGCGCGGGGTCGAGAATGGCTGGATCCTCCCCGATCCCGACCTGCTGCTGTC
GCGCCAGCACTGTGTCTTCGAGAAGACCGCGGCCGGCTACCGGGTGATCGACACCAGCACCAACGGCGTC
TTCCTCAACGGTTCCGACCGGCCGCTCGGCCGCAATGTGCCGGCGGCTCTCGGGTCGGGCGACCGTATCC
GCATCGGTCGCTTCATCATCGAGGCGACGGTGGAAACGCTGTCCGCCCCCAGCTTCACCGAGATTTCCGG
CGCCTTCCGGTTGGGCGGGACCGATAGCGCGCCCGATCCCTTCGCCCCCGATCCCTTCGCCCCGCCGCCG
CCCGCTGCCGCGGCACCGGACCGGTTCGACGAGCTGTTCGCCGACCCCCTCGCCGGTTCCGTCGAGCAGC
GCCCGTTCGAACACCGGCCGCTGCGGTCGGAAGAGGCGCCCTTCGATGCCTGGACCGCGTCCAGCAGCGG
TGCGGCGCCGCGCGAGCGGGCGGACGACTGGCGGTTCGGCACGGTGGACGACCATTCCGACCCGCTGAAC
CAGTCGCTGTCCATCGGCGTCTCGTATCAGCCGCCTGCCGCCGCACCGCCGCCGTCGGGCGGGGGCATCC
CCGACGACTGGGACGACGAGCTGTTCGCCCCGCCGAAGCCGGCGGCCTCCACCGTCCCGCACCCGGCCTT
CCCCGCCGCGGCGAAGACGGCCCAGCCGTTGCCGGAAGACTGGAACATCGACGAGACGCTGCCCGATCCG
GCGGCCGATCCGCTGCCGGCGGAGCCGTCGCCGGTCGCCCGGGTGGCCGAGCCGATCCCGCTGCCGGACG
ACTCCGTCATCGTTCCCCACGCGGTGCCGCAGGTCGTGCCGCCGCCGCCCGCGCCCGTGTCCCCTCCCGC
GCCGCTCGCCGCGCCCGTTACCGACGCGGGTGCCGCGGTCGCCGCCTTCTATGAGGGGTTCGGCGCGCCG
CTGCCGGCGGACGGGCTGCCGGACCCGACTGCGACGATGCGCAACCTGGGCGAGGCGCTGCGCGTCAGCC
TGGGGGCGCTGCATGCGTCGCTGCGGGCGCGCTCCCGTTTCAAGGACGAGTTCCATCTGGAGCAGACCAG
CTTCCGCCCGGCGGGGGAGAACCCGCTGAAGCGGTGCGAGACGCTTGACGAGGCGGTGTCGGTGCTGGCC
AACCCGCGCCTGCGCGGCTTCCTGCCGATGGCCGACGCGGTGCGCGAGGCGGCGAGCGATGTGCAGGTCC
ACCACCTCGCCTATGCCGCGGCGCTGCAGACCGCGCTGAAGCAGGTGGTCGCCAAGTTCGATCCCGGCGC
GCTCAGCCAGCGGCTGGAGACGCGGCTTCTCGACAGCATCGTTCCGGCGGCGCGCAAGGCCCGCTACTGG
GACCAGTACGAGACGCTCTACAAGGATCTGGTGGTCGAGCTGGAAGAGGATTTCGACCGGGTGATCGGCG
ACGCCATCGCCCGCGAATACGACCGCTTCGTGCGCGGCGACACCGGCCGGGATCCGGAGGGCGGATCGCC
GGACTGA