SecReT6
Protein ID: 374300582
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2235
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2476499..2477035 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF3YWR9
KEGG IDdaf:Desaf_2235
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.80E-23, Aligned region: 15..159
Protein Sequence: 178 a.a.     [Download]
>gi|374300582|ref|YP_005052221.1| type VI secretion lipoprotein [Desulfovibrio africanus str. Walvis Bay]
MASYSIPIWFFLLPLIVGCGGKSGSVIWSHAKDAISLEIVADGSLNQYAGEPHTLALCVHQLSDPDKFGE
LSGTPSGVLALLKCDSFDASVSGYRRIVAQPGEQKILFLDRAENARFIGISAGYYNVNPAQATRLFEIPI
DEHKQGYIPFFRDTVRQPGRLKINLLLDPQEIQDVGGD
 
Nucleotide Sequence: 537 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2476499-2477035 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGGCAAGCTATTCCATTCCAATATGGTTTTTTTTGCTGCCGCTCATCGTCGGCTGCGGCGGCAAGTCCG
GCAGTGTCATATGGTCCCACGCCAAGGACGCAATATCCCTGGAGATTGTTGCGGATGGAAGCCTGAATCA
ATACGCTGGTGAACCGCACACGCTGGCGCTTTGCGTCCATCAGCTTTCCGATCCCGATAAATTCGGTGAA
CTCTCGGGGACCCCCTCAGGCGTGCTCGCCCTGCTCAAGTGCGACAGTTTCGATGCAAGCGTCTCCGGCT
ACAGGCGTATCGTCGCCCAACCAGGCGAACAGAAAATCCTTTTCCTGGACAGGGCCGAGAATGCCCGCTT
TATCGGCATATCCGCCGGCTACTACAACGTAAATCCGGCTCAGGCCACCCGGCTGTTCGAGATCCCCATC
GATGAGCACAAGCAGGGCTATATTCCATTTTTCAGGGATACCGTGCGCCAGCCCGGTCGGCTCAAGATCA
ATCTCCTCCTGGACCCCCAGGAGATTCAAGATGTCGGGGGAGATTAA