SecReT6
Protein ID: 374300583
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2236
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2477035..2478423 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDF3YWS0
KEGG IDdaf:Desaf_2236
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.40E-100, Aligned region: 19..461
Protein Sequence: 462 a.a.     [Download]
>gi|374300583|ref|YP_005052222.1| type VI secretion protein [Desulfovibrio africanus str. Walvis Bay]
MRTDRPILWQQGQFLQPQHFQLLDRYHESLLNPLRQYLRPYFWGVISLEIHEAALSNARFELSKGEFLFP
DGELVSYPGNALLRPRSFEAEWTDFQRPFKVYLGLRRQDSQDGNVEVIDGPDGLADMPKRYTSRSGPEEA
GDQYGQGPVAQVRFLNYGLRLFWESELERAQNYSLLPIASLERDGGEVRVCRRYIPPCLTLSACGLLREM
VRGLKDQLVSRCRQLEEYKSPREVQVSALDAGYFVFLLALRSLNRYLPQLCHLLEAPHIHPWDVYGVLRQ
LAGEMSTFSEDLNALGERRDSTLAVPQYDHGDLWRCFSELSVLVEQLFSSISVGPEHTVRLEPEGSYLSA
SFEPRHFQESNSYWLVLHTSTSPEEVLESVRNMAKLSAAAKITTLVAMAVPGVPLHYFPVPPPGLPRRAK
SFYFRIDHESPQWGEVQRTRRVSLYWDSKPEDLAGEIVILRN
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2477035-2478423 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGCGTACAGACAGGCCCATCCTTTGGCAGCAGGGACAGTTTCTCCAGCCTCAGCACTTCCAGCTCCTGG
ATCGCTATCATGAATCGCTGCTGAACCCCCTGCGGCAGTACCTGCGTCCCTACTTCTGGGGTGTCATTTC
CCTGGAAATCCACGAGGCAGCCCTGAGCAACGCCAGGTTCGAGCTGAGCAAGGGGGAGTTCCTGTTCCCT
GACGGCGAACTGGTGTCTTATCCGGGCAACGCCCTGCTGCGGCCGCGATCCTTCGAGGCCGAGTGGACCG
ATTTCCAGCGGCCCTTCAAGGTCTACCTTGGCCTGCGCAGGCAGGATAGCCAGGACGGCAACGTCGAGGT
CATCGATGGCCCGGACGGGCTGGCCGACATGCCGAAGCGCTACACCTCCCGCTCCGGACCGGAAGAGGCC
GGCGACCAGTATGGCCAGGGCCCGGTGGCCCAGGTGCGCTTCCTGAATTACGGGCTCAGGCTCTTCTGGG
AGTCGGAGCTTGAGCGGGCCCAGAACTATAGTCTGCTGCCCATCGCCAGCCTGGAGCGCGACGGCGGTGA
GGTCCGGGTCTGCAGGCGCTACATTCCACCGTGCCTGACCCTGTCAGCCTGCGGCCTGCTCAGGGAGATG
GTGCGCGGCCTCAAGGACCAGCTCGTTTCGCGCTGCCGCCAGCTCGAGGAGTACAAGAGCCCGCGCGAGG
TGCAGGTCAGCGCCCTGGATGCGGGTTATTTCGTGTTCCTGCTGGCCCTGCGCTCCCTGAACAGGTATTT
GCCGCAGCTCTGCCATCTGCTCGAAGCGCCGCATATTCATCCCTGGGACGTGTACGGGGTCCTGCGTCAG
CTCGCAGGGGAAATGAGCACCTTTTCCGAGGACCTGAACGCCCTTGGCGAGCGCAGGGATTCCACCCTGG
CCGTTCCGCAATACGACCACGGAGACCTTTGGCGCTGCTTCTCCGAGTTGAGCGTGCTCGTCGAGCAGCT
GTTCAGCTCCATCAGCGTGGGTCCGGAACACACCGTCCGCCTGGAGCCCGAGGGCAGCTACCTGAGCGCC
TCCTTCGAGCCGCGCCACTTCCAGGAGAGCAACTCCTACTGGCTCGTCCTGCACACCTCGACCTCGCCGG
AGGAGGTCCTGGAGTCCGTGCGCAACATGGCCAAGCTCTCGGCTGCGGCCAAGATCACCACCCTTGTGGC
CATGGCCGTGCCGGGCGTGCCCCTGCACTATTTCCCGGTGCCGCCGCCGGGTCTGCCCAGGCGGGCCAAG
TCCTTCTATTTCCGGATCGACCATGAGAGCCCCCAGTGGGGCGAAGTCCAGAGAACGCGCCGGGTGTCGC
TTTACTGGGACTCCAAGCCAGAGGACCTGGCCGGCGAAATCGTCATCCTGAGGAATTAA