SecReT6
Protein ID: 374300586
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2240
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2485130..2485612 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDF3YWS3
KEGG IDdaf:Desaf_2240
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.40E-55, Aligned region: 4..158
Protein Sequence: 160 a.a.     [Download]
>gi|374300586|ref|YP_005052225.1| type VI secretion protein [Desulfovibrio africanus str. Walvis Bay]
MKDGSVAPKERVNITYKPATGSAKEEVELPLKLLVMGDFTQSQDDRPVDQREPVNVGKENFQEVLKAQNL
GLKLTVPNRLADKEGGQLTLDLKFQSLKDFDPDSIVKNVPELAKLVELRDALLALKGPLGNVPEFRKKIQ
ELVSDPGARERLLKELGLEG
 
Nucleotide Sequence: 483 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2485130-2485612 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGAAAGACGGTTCCGTGGCCCCAAAAGAGCGGGTGAACATTACCTACAAGCCCGCCACGGGCAGTGCGA
AGGAAGAGGTTGAGCTTCCCCTGAAGCTTTTGGTCATGGGCGACTTCACTCAGAGCCAGGACGACCGCCC
GGTCGACCAGCGCGAGCCCGTGAACGTGGGCAAGGAAAATTTTCAGGAGGTCCTCAAGGCGCAGAACCTG
GGACTCAAGCTTACGGTCCCGAACCGCCTCGCCGACAAGGAGGGCGGACAGCTGACCTTGGACCTCAAGT
TCCAGAGCCTCAAGGATTTTGATCCGGACAGCATTGTCAAGAACGTGCCGGAACTGGCCAAGCTGGTCGA
ACTCAGGGATGCGCTGTTGGCCCTGAAGGGACCCTTGGGCAACGTTCCCGAGTTCCGCAAGAAGATTCAG
GAGCTGGTTTCCGATCCAGGAGCGCGCGAGCGCCTGCTCAAGGAACTGGGCCTCGAAGGATAA