SecReT6
Protein ID: 374300587
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2241
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2485624..2487111 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDF3YX69
KEGG IDdaf:Desaf_2241
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-182, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|374300587|ref|YP_005052226.1| type VI secretion protein EvpB [Desulfovibrio africanus str. Walvis Bay]
MAEEVLKQAKPEASTAGGEPSLLDEIVQATKVKPSDESYSATRVGVQAFIDELLKPGREGIRVTQAVITE
MIANIDQKLSTQVDAILHDSQFQKLESAWRGLKFLVERTDFRENIKISMVNLSKEDLLADFEDAPELTKS
GLYKMLYTAEYGQFGGQPYGAMVANYEFGPGPRDISLLQSVAATSAMAHAPFIAAAGESFFGVDSFEQLP
NLKDLKSVFEGPQHAKWRGFRESEDSRNVGLVLPRFLLRLPYGPETIPSKNFEYRENVSAGDTSFLWGNA
AFAFASCLTDSFAKYRWCANVIGPQGGGAVYDLPVYTYEAMGATQAKIPTQTLISERREFELAEEGFIAL
AMRKGSDNAAFFSANSCQKPKFFGNTKEGKEAETNYKLGTQLPYMFVISRLTHYIKVLQRENIGTWKQRT
DLETELNNWIRQYVADQESPSAGVRSRRPLRRAEISVNDIPGDPGWYGVTLKVMPHFKYMGANFELSLVG
KLDKE
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2485624-2487111 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGGCTGAAGAAGTGCTCAAGCAAGCCAAGCCGGAGGCCTCTACGGCAGGAGGAGAGCCCTCCCTGCTGG
ACGAGATCGTCCAGGCCACCAAGGTCAAGCCTTCCGATGAATCGTACTCCGCGACCAGAGTCGGCGTGCA
GGCGTTCATCGACGAGCTCCTCAAGCCCGGCCGGGAAGGCATCCGGGTGACCCAGGCGGTCATCACCGAA
ATGATTGCGAACATCGACCAGAAGCTGTCGACCCAAGTCGACGCCATCCTGCACGACAGCCAGTTCCAGA
AGCTCGAATCGGCCTGGCGGGGTCTCAAGTTCCTCGTGGAGCGCACGGACTTCCGGGAGAACATCAAGAT
CTCCATGGTCAACCTGAGCAAAGAGGATCTGCTGGCCGACTTCGAGGATGCGCCGGAGCTGACCAAGTCC
GGGCTCTACAAGATGCTTTACACGGCGGAATACGGGCAGTTCGGCGGCCAGCCCTATGGGGCCATGGTGG
CCAACTACGAGTTCGGGCCCGGGCCCAGGGACATCTCGCTGCTGCAGTCCGTGGCCGCGACCTCGGCCAT
GGCCCATGCCCCGTTCATAGCCGCTGCCGGGGAGTCCTTCTTCGGGGTGGATTCCTTCGAGCAGCTCCCG
AACCTGAAGGACCTGAAGTCGGTCTTCGAAGGGCCGCAGCACGCCAAGTGGCGCGGCTTCAGGGAGTCGG
AGGATTCGCGCAACGTGGGCCTGGTCCTGCCGCGCTTCTTGCTCAGGTTGCCCTACGGCCCGGAGACCAT
CCCGTCCAAGAACTTCGAATACCGTGAGAACGTCTCGGCCGGAGACACGAGCTTTCTGTGGGGCAACGCG
GCCTTTGCCTTTGCCTCCTGCCTGACGGACAGCTTCGCCAAGTACCGCTGGTGCGCGAACGTCATCGGCC
CCCAGGGCGGCGGAGCGGTGTACGATCTGCCGGTCTACACCTACGAGGCCATGGGCGCGACCCAGGCCAA
GATCCCTACCCAGACGCTCATATCCGAGCGCAGGGAGTTCGAGCTGGCCGAGGAGGGCTTCATAGCCCTG
GCCATGCGCAAGGGCAGCGACAATGCGGCCTTTTTCTCGGCCAACTCGTGTCAGAAGCCGAAGTTCTTCG
GCAACACCAAGGAAGGCAAGGAGGCCGAGACGAACTACAAGTTGGGCACACAGCTGCCCTACATGTTCGT
CATCAGCAGGCTGACCCACTACATCAAGGTCCTCCAGCGCGAGAACATAGGCACTTGGAAGCAGCGCACC
GACCTGGAGACGGAACTGAATAACTGGATCCGCCAGTACGTGGCCGACCAGGAGAGCCCCTCGGCCGGCG
TGCGCTCCAGGCGTCCCCTGCGCCGCGCGGAGATATCGGTCAACGACATCCCGGGCGATCCGGGCTGGTA
CGGAGTGACGCTCAAGGTCATGCCCCACTTTAAGTACATGGGCGCGAACTTCGAGCTGTCTCTCGTTGGC
AAGCTGGACAAGGAATAG