SecReT6
Protein ID: 374300588
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2242
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2487163..2487645 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDF3YX70
KEGG IDdaf:Desaf_2242
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-36, Aligned region: 6..145
Protein Sequence: 160 a.a.     [Download]
>gi|374300588|ref|YP_005052227.1| type VI secretion system effector [Desulfovibrio africanus str. Walvis Bay]
MALTSYMTIKGKSQGDIKGDCTQKGREGSIIVYAIDHSVEIPQDPHSGLPTGQRLHKPFIVTKHKDQASP
KLFQACCTGEQIEVSIDYYRISEKGQEEKYYTVKMQNAIIVGLKHQKPMTFLEANKPYKDMETVLFGYAK
MIQTYVPDGIEAEDSWLTPK
 
Nucleotide Sequence: 483 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2487163-2487645 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGGCGTTGACCAGCTACATGACGATCAAGGGCAAGTCCCAGGGCGACATCAAGGGCGACTGCACCCAGA
AGGGCAGGGAAGGCAGCATCATCGTGTACGCCATCGATCATTCGGTGGAGATACCCCAGGACCCGCATTC
GGGCCTGCCCACGGGACAGAGGCTGCACAAGCCCTTCATCGTGACCAAGCACAAAGACCAGGCCTCGCCC
AAGCTCTTCCAGGCCTGCTGCACCGGCGAGCAGATCGAGGTGAGCATCGACTACTACCGCATCAGCGAGA
AGGGACAGGAAGAAAAGTACTACACCGTCAAGATGCAGAACGCGATCATCGTGGGTCTCAAGCACCAGAA
GCCCATGACCTTCCTCGAAGCGAACAAGCCCTACAAGGACATGGAGACCGTGCTCTTCGGCTACGCGAAG
ATGATTCAGACCTATGTGCCCGACGGCATCGAGGCTGAGGATTCCTGGCTTACGCCCAAGTAG