SecReT6
Protein ID: 374300589
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2243
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2487751..2488167 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF3YX71
KEGG IDdaf:Desaf_2243
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-17, Aligned region: 30..117
Protein Sequence: 138 a.a.     [Download]
>gi|374300589|ref|YP_005052228.1| type VI secretion system lysozyme-like protein [Desulfovibrio africanus str. Walvis Bay]
MIDIRLLERIRLLEKNPERRGVSDSVGIYRSVMNHLRHILNTRQGSAPIAEEFGMPDFTDLPSSYGLDTV
RDLERTLQCIIESFEPRLADVRVTALPLDDNHLGLKFQITGRLLLESASSPVEIQALVSPQGNVSLGE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2487751-2488167 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGATCGACATACGGCTGCTTGAGCGCATCCGCCTGCTGGAGAAGAATCCGGAAAGGCGAGGGGTGTCCG
ACAGCGTGGGCATCTACCGCTCGGTGATGAACCACCTGCGCCACATCCTGAACACGCGACAAGGCAGCGC
GCCCATTGCCGAGGAATTCGGCATGCCCGACTTCACGGACCTGCCGAGCTCCTACGGCCTGGATACGGTC
AGGGACCTGGAGCGGACCCTGCAGTGCATCATCGAGAGCTTCGAGCCGCGGCTCGCGGATGTCCGGGTGA
CCGCCTTGCCGCTGGACGACAACCACCTCGGCCTGAAGTTCCAGATCACCGGCAGGCTGCTGCTCGAGAG
CGCCTCAAGTCCGGTGGAGATCCAAGCCCTCGTATCGCCCCAAGGCAATGTCAGCCTGGGCGAGTGA